Details for Arabidopsis Locus AT3G16220

Position : Chr3 ( 5`- 5497597 .. 5499235 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16220

Protein [Map View]
MENLNHKWDRCSSSHQTPLSFKGNQKQIGQGQREVFTHFVSLPLAIYPDLTKNIEAFQNSVLGNNDKDPLKFQSTLAEMG
IEKSIFVTPKTFHLTVVMLKLENNESVVKAQNILQSIFSNVRQALKNRPVFIRLRGLECMSGSLDKTRVLYAPVEEVGRE
GRLLNACHVIIDAFENVGFAGKDAKSRLKLHATLMNASYRKDKSKKMDTFDAREIHKEFENKDWGTYLIREAHISQRYKY
DPNGYFHCCASLPFPHK*

DNA
ATGGAGAATTTAAATCATAAGTGGGATCGTTGTTCCTCTTCTCATCAAACTCCTCTTTCTTTCAAAGGCAATCAGAAGCA
GATTGGACAAGGTCAGAGAGAAGTGTTCACACATTTTGTGTCACTTCCATTAGCCATATACCCTGACTTGACGAAAAATA
TCGAGGCTTTTCAGAATTCTGTATTGGGAAACAATGATAAGGATCCATTGAAGTTTCAGAGTACTTTAGCTGAAATGGGA
ATAGAAAAATCGATCTTTGTAACTCCCAAAACTTTCCATTTGACTGTGGTTATGTTAAAGTTAGAGAACAATGAATCTGT
GGTTAAAGCTCAGAATATCCTTCAGAGTATTTTTTCTAATGTGAGGCAAGCTTTGAAAAACAGACCTGTCTTCATAAGAC
TCAGAGGATTGGAATGTATGAGTGGATCTTTAGACAAAACTCGCGTTCTCTATGCTCCTGTTGAAGAAGTTGGTCGTGAG
GGCCGCCTGCTAAATGCTTGTCATGTTATCATTGATGCATTTGAGAATGTTGGATTTGCTGGTAAAGATGCAAAGTCACG
CTTGAAGCTACACGCCACGTTGATGAATGCAAGCTACAGAAAAGATAAAAGCAAAAAGATGGATACTTTTGATGCTCGAG
AGATACACAAAGAGTTTGAGAACAAGGATTGGGGAACATATCTAATCAGAGAAGCTCACATCTCACAACGTTATAAGTAT
GACCCCAATGGCTACTTCCATTGCTGCGCTTCACTACCTTTTCCACATAAGTGA