Details for Arabidopsis Locus AT3G16210

Position : Chr3 ( 5`- 5494533 .. 5495615 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16210

Protein [Map View]
MSKFLPEELAIEILVRLSMKDLARFRCVCKTWRDLINDPGFTETYRDMSPAKFVSFYDKNFYMLDVEGKHPVITNKLDFP
LDQSMIDESTCVLHCDGTLCVTLKNHTLMVWNPFSKQFKIVPNPGIYQDSNILGFGYDPVHDDYKVVTFIDRLDVSTAHV
FEFRTGSWGESLRISYPDWHYRDRRGTFLDQYLYWIAYRSSADRFILCFNLSTHEYRKLPLPVYNQGVTSSWLGVTSQKL
CITEYEMCKKEIRISVMEKTGSWSKIISLSMSSFISVQDRIYDYQVEFVSFTRKNDLVVTFTGYNDHFEMEPEERTKKKM
FLYKTGNERSEEVRFCNPLAGLRFLCECVETLKIVNRIFI*

DNA
ATGTCGAAATTTCTCCCGGAAGAATTAGCCATTGAGATTCTAGTGAGGCTATCGATGAAGGATCTTGCTCGATTCAGATG
CGTCTGCAAGACATGGAGAGATCTTATCAACGACCCTGGATTCACAGAAACGTACCGAGACATGTCTCCGGCAAAGTTCG
TGTCGTTTTACGACAAGAACTTTTACATGCTTGACGTTGAAGGCAAGCATCCGGTTATTACAAACAAGCTCGATTTCCCC
TTGGATCAGTCAATGATCGATGAATCTACATGTGTGCTTCATTGTGATGGGACTTTATGTGTTACCTTAAAGAATCACAC
TTTAATGGTTTGGAATCCGTTTTCGAAGCAATTCAAGATCGTACCAAATCCCGGTATATACCAAGATTCAAACATTCTGG
GTTTCGGTTATGACCCGGTTCACGACGATTACAAAGTCGTAACGTTTATCGACCGGCTTGATGTTTCCACGGCGCATGTT
TTCGAATTTAGAACCGGTTCATGGGGAGAGAGCCTACGTATTTCTTATCCTGATTGGCATTACAGAGACAGGAGAGGTAC
ATTTTTGGACCAATACCTCTATTGGATTGCGTACCGGTCTAGTGCTGACCGGTTTATCCTATGCTTTAATCTCTCAACAC
ATGAATACCGAAAACTCCCTCTCCCGGTTTACAACCAAGGCGTGACGTCTTCATGGTTAGGCGTTACAAGTCAAAAACTC
TGTATTACAGAGTATGAAATGTGCAAGAAGGAGATTCGGATTTCGGTTATGGAGAAAACCGGATCATGGAGCAAGATTAT
AAGCCTTTCAATGTCGAGTTTCATCTCTGTACAAGATCGTATCTACGATTATCAAGTCGAATTCGTGTCGTTTACTAGAA
AGAACGATCTCGTCGTAACATTCACTGGATACAACGATCATTTCGAGATGGAACCTGAAGAGCGTACGAAGAAGAAGATG
TTCTTGTACAAAACCGGAAACGAGAGATCTGAAGAAGTCCGGTTCTGTAACCCTCTAGCCGGGTTACGGTTTCTCTGTGA
ATGTGTGGAGACTCTTAAGATTGTTAATCGCATATTTATTTGA