Details for Arabidopsis Locus AT3G16200

Position : Chr3 ( 5`- 5491406 .. 5493629 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16200

Protein [Map View]
MERGMNNGQSLWHSQSPKTPTTMLDRALSSRRPHSDADLSASGESGTDESKTKRPHIYLLASNFLSRIGHQWWPCLILAL
LFLVLLFLISVAFHSHSFVCISRFDPAARIGFFGLDGLESDFGALGVPWCRSKHGKEVEWTSKDLLKGLEEFVPIYETRP
IKNNMYGMGFDHSFGLWFMARWLKPDMMIESGAFKGHSTWVLRQAMPDTPMISLTPRHPEKYLRKGPAYVDGNCTYFAGK
DFVDFGSVDWKNVLRKHGITDLSRVIVFFDDHQNELKRLKQALKAGFRHLIFEDNYDTGTGDHYSLRQICDQSHIRGGGH
SCFKDSDEARMRSKRKKFWEKAVDTEELCGPGETWWGVKGEMRDDFNHTNTPISYNQHFQNSRYVESILDVYWELPPVAG
PSLTHQSRYDPARATPPIVADGKHRLFQRIGLGRLDKSVFNGYTQMVYLEISKPGS*

DNA
ATGGAGAGAGGAATGAACAATGGGCAATCACTCTGGCACTCTCAGTCACCGAAAACTCCAACGACGATGCTAGATCGGGC
TCTTTCCTCTCGCCGTCCTCACTCCGACGCCGATCTCTCTGCTTCCGGCGAATCCGGAACCGACGAATCTAAAACCAAAC
GCCCACACATCTACCTCCTTGCTTCCAATTTCCTTTCTCGGATCGGTCATCAGTGGTGGCCTTGTCTCATTCTCGCTCTC
CTCTTCCTCGTCCTTCTCTTCCTCATCTCCGTTGCTTTCCATTCTCACAGCTTTGTTTGCATCTCCCGCTTCGATCCCGC
TGCTCGGATCGGGTTTTTCGGTCTTGATGGCCTCGAATCGGATTTTGGTGCCCTAGGTGTTCCTTGGTGCAGATCGAAAC
ATGGAAAAGAAGTTGAGTGGACATCCAAAGATTTACTCAAGGGTCTAGAAGAGTTTGTGCCGATATATGAAACACGACCG
ATAAAGAACAATATGTATGGAATGGGTTTTGATCATAGCTTTGGGTTATGGTTCATGGCCCGTTGGCTAAAGCCAGATAT
GATGATTGAGAGTGGTGCTTTTAAGGGACATTCTACTTGGGTTCTGCGGCAGGCGATGCCAGATACACCTATGATTTCAC
TTACTCCTAGGCACCCTGAGAAGTATCTGAGAAAGGGACCTGCTTATGTAGATGGAAACTGCACATACTTTGCAGGCAAA
GATTTTGTTGATTTTGGAAGTGTTGATTGGAAGAATGTGTTGAGAAAACATGGTATAACAGATCTCAGCCGTGTAATTGT
CTTTTTCGATGACCATCAGAATGAACTCAAAAGGCTAAAGCAGGCACTGAAAGCTGGTTTCCGACATCTCATTTTCGAGG
ATAACTACGATACAGGAACCGGGGATCACTATTCGCTGAGACAGATATGTGATCAGTCACATATAAGAGGAGGCGGACAC
AGCTGTTTCAAAGACAGCGATGAAGCTAGGATGAGATCAAAGAGGAAGAAGTTCTGGGAAAAAGCAGTTGATACAGAGGA
ACTGTGCGGACCAGGGGAAACATGGTGGGGAGTTAAAGGAGAAATGAGAGATGATTTCAACCACACTAACACGCCGATCT
CATACAATCAGCATTTTCAAAACAGTCGCTACGTTGAATCAATTCTTGACGTCTATTGGGAGCTACCTCCGGTCGCAGGA
CCTTCATTAACCCATCAGTCGCGGTATGACCCTGCTCGAGCGACTCCACCAATCGTAGCAGATGGCAAGCACCGGTTGTT
CCAACGAATCGGTTTAGGTCGTCTGGATAAGTCAGTGTTCAATGGGTATACTCAAATGGTATACCTTGAGATATCCAAGC
CCGGGTCATAG