Details for Arabidopsis Locus AT3G16150

Position : Chr3 ( 5`- 5471735 .. 5473276 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16150

Protein [Map View]
MGGWAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIALRSNVSAIDVVELVIRELETDPLFNSGRGSALTEKGTVEM
EASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEDFARKQGVEIVDNEYFVTDDNVGMLKLAKEANSI
LFDYRIPPMGCAGAAATDSPIQMNGLPISIYAPETVGCVVVDGKGHCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASEFC
GVSCTGEGEAIIRATLARDVSAVMEYKGLNLQEAVDYVIKHRLDEGFAGLIAVSNKGEVVCGFNSNGMFRGCATEDGFME
VAIWE*

DNA
ATGGGTGGGTGGGCAATCGCAGTACACGGTGGTGCCGGTATCGACCCTAATCTTCCGGCGGAGAGACAAGAAGAGGCTAA
ACAGCTTTTAACTCGTTGTCTCAACCTCGGCATAATAGCTTTGCGTTCCAATGTCTCCGCCATTGACGTCGTTGAGCTCG
TCATTAGAGAATTGGAGACGGATCCTCTGTTTAATTCAGGCCGTGGATCTGCTTTGACGGAAAAAGGAACGGTTGAGATG
GAAGCTAGCATTATGGACGGTACGAAGAGACGATGCGGTGCCGTTTCGGGGATAACCACCGTGAAAAATCCTATATCTCT
TGCTCGTCTCGTCATGGACAAATCTCCCCACTCTTACCTTGCTTTCTCAGGTGCAGAGGATTTCGCCCGCAAACAGGGAG
TTGAAATTGTGGACAACGAGTACTTTGTCACGGACGACAACGTAGGAATGCTCAAGTTGGCCAAGGAAGCTAACTCCATC
TTGTTTGATTACCGGATTCCGCCGATGGGATGTGCCGGTGCAGCTGCGACCGACAGTCCAATCCAAATGAACGGTCTTCC
GATCAGCATTTACGCACCGGAGACAGTCGGGTGCGTTGTGGTTGACGGGAAAGGACATTGTGCCGCCGGGACATCCACGG
GTGGTTTAATGAACAAGATGATGGGAAGGATTGGTGACTCGCCGCTGATAGGAGCCGGGACGTATGCGTCGGAGTTTTGT
GGTGTGTCGTGTACCGGAGAAGGAGAAGCCATTATAAGAGCAACCCTAGCTCGTGATGTGTCAGCTGTTATGGAGTATAA
AGGACTTAACCTCCAAGAAGCGGTTGATTACGTCATCAAGCATCGACTTGACGAAGGGTTCGCTGGACTCATTGCTGTCT
CGAATAAAGGAGAGGTGGTTTGTGGTTTTAACTCTAATGGGATGTTCAGGGGATGTGCAACTGAGGATGGATTCATGGAG
GTTGCTATTTGGGAGTGA