Details for Arabidopsis Locus AT3G16140

Position : Chr3 ( 5`- 5468509 .. 5469481 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16140

Protein [Map View]
MASLATVAAVKPSAAIKGLGGSSLAGAKLSIKPSRLSFKPKSIRANGVVAKYGDKSVYFDLEDLGNTTGQWDVYGSDAPS
PYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSATSTGEVLPIKRGPQEPPKLGPRGKL*

DNA
ATGGCGTCTCTTGCAACCGTCGCCGCTGTGAAACCATCCGCCGCCATAAAAGGACTCGGCGGCAGCTCACTCGCCGGAGC
TAAGCTCTCCATCAAGCCTTCCCGCCTGAGCTTTAAACCCAAATCCATCCGGGCTAATGGTGTGGTGGCTAAGTATGGAG
ACAAAAGTGTCTACTTTGACTTAGAAGATTTGGGTAACACAACAGGTCAATGGGACGTATACGGCTCTGATGCTCCTTCT
CCTTACAATCCTCTTCAGAGCAAGTTCTTTGAGACATTCGCTGCCCCATTCACAAAGAGAGGATTGCTCCTCAAGTTCTT
GATCCTTGGAGGAGGCTCTTTGCTTACTTATGTCAGCGCTACCTCTACCGGCGAAGTTCTTCCCATCAAGAGAGGTCCTC
AGGAGCCGCCTAAGCTCGGTCCTCGCGGCAAGCTCTGA