Details for Arabidopsis Locus AT3G16120

Position : Chr3 ( 5`- 5464769 .. 5465531 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16120

Protein [Map View]
MLEGKAKVEETDMPVKMQMQAMKIASQSLDLFDVFDSISIAAHIKKEFDERYGSGWQCVVGTNFGCFFTHSKGTFIYFHL
GTLNFLIFKGATL*

DNA
ATGTTGGAAGGGAAAGCGAAGGTGGAAGAGACAGACATGCCTGTGAAGATGCAAATGCAAGCAATGAAGATTGCTTCTCA
ATCTCTCGATCTTTTTGATGTCTTTGATTCTATATCCATCGCTGCTCACATCAAGAAGGAGTTCGATGAGAGATATGGAA
GTGGATGGCAATGTGTCGTGGGAACCAATTTTGGGTGTTTCTTCACACATTCTAAAGGAACTTTCATCTATTTTCATTTG
GGGACTCTCAACTTCCTCATCTTCAAAGGCGCCACTCTTTAG