Details for Arabidopsis Locus AT3G16090

Position : Chr3 ( 5`- 5456144 .. 5458966 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16090

Protein [Map View]
MIRLRTYAGLSFMATLAVIYHAFSSRGQFYPATVYLSTSKISLVLLLNMCLVLMLSLWHLVKFVFLGSLREAEVERLNEQ
AWRELMEILFAITIFRQDFSSGFLPLVVTLLLIKALHWLAQKRVEYIETTPSVSKLSHFRIVSFMGFLLLVDSLFMYSSI
RHLIQSRQASVSLFFSFEYMILATTTVAIFVKYVFYVTDMLMDGQWEKKPVYTFYLELIRDLLHLSMYICFFFVIFMNYG
VPLHLLRELYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDATCIICREEMTNAKKLICGHLFHVHCLRSWL
ERQQTCPTCRALVVPPENATSAAPGQRELHQGSQQGTSSSGNQGSEISSSAGVSNNSLSRHHARLQAAASAASVYGKSMV
YPSANTVAWSSGVPGTEQVSTEPDQTLPQHNLPVENSHAYANMSETKLEEMRKSLETHLEILRNRLHFLETRKPESAGEP
ENKGKSVADAAE*

DNA
ATGATTCGACTAAGAACATACGCAGGCCTTAGTTTTATGGCAACTTTGGCTGTAATTTATCATGCATTCAGCAGCAGAGG
CCAATTTTACCCTGCGACTGTTTATCTATCAACCTCAAAGATCAGTTTGGTGTTGCTTCTCAATATGTGTTTGGTTCTTA
TGCTTAGTCTCTGGCATTTGGTCAAATTTGTCTTCTTGGGGTCTCTTAGGGAAGCAGAAGTCGAGAGGCTAAATGAACAA
GCTTGGAGAGAACTTATGGAGATTCTCTTTGCCATTACTATCTTTAGACAAGACTTTTCTAGTGGGTTTCTTCCTTTGGT
TGTTACTCTTCTGTTGATCAAGGCTTTACATTGGCTTGCTCAGAAAAGAGTTGAATACATTGAGACTACTCCTTCTGTCT
CTAAGCTTTCTCATTTTCGTATTGTCTCTTTTATGGGTTTCCTTCTTCTTGTGGATAGTTTATTTATGTACAGTTCTATA
CGCCACTTGATTCAGTCGCGTCAGGCTTCGGTTTCTCTCTTCTTCTCATTCGAGTATATGATACTGGCGACAACGACTGT
TGCTATTTTTGTGAAGTATGTTTTCTATGTCACTGATATGTTAATGGATGGTCAATGGGAGAAGAAGCCAGTTTATACTT
TCTATCTTGAGCTTATCCGTGACCTGCTTCACTTGTCCATGTATATCTGCTTCTTCTTTGTCATATTCATGAACTATGGC
GTGCCTTTGCATTTGTTACGGGAGCTCTACGAAACCTTCAGAAACTTCCAGATTCGTGTTTCCGATTACCTTCGTTATCG
TAAGATCACGTCCAATATGAACGACAGGTTTCCTGATGCAACTCCTGAAGAACTTACTGCAAGTGATGCCACATGTATCA
TATGCCGTGAAGAGATGACAAATGCGAAGAAACTAATATGCGGGCATCTCTTTCATGTGCATTGTCTACGATCATGGTTG
GAGAGACAGCAGACATGTCCTACTTGCAGAGCACTTGTTGTACCTCCTGAGAATGCCACCTCTGCAGCTCCAGGCCAACG
TGAATTACACCAAGGTTCCCAACAGGGTACATCAAGCTCAGGTAACCAGGGCTCTGAAATAAGTTCTTCAGCTGGCGTTT
CCAATAATAGTTTGAGCAGGCACCACGCCAGGCTTCAAGCAGCTGCTTCTGCAGCCTCCGTGTATGGGAAATCAATGGTT
TACCCATCTGCAAACACAGTAGCATGGTCGTCGGGAGTTCCTGGAACAGAGCAAGTGTCAACTGAACCAGATCAAACTCT
TCCTCAACACAACCTTCCTGTTGAAAACTCTCATGCCTATGCAAATATGTCGGAGACTAAGCTAGAAGAAATGAGAAAAT
CTCTGGAAACCCACCTCGAGATTTTGCGAAACCGACTTCACTTTCTGGAGACGAGGAAACCAGAATCCGCAGGGGAACCA
GAGAACAAAGGAAAGTCGGTTGCTGATGCAGCAGAGTGA