Details for Arabidopsis Locus AT3G16080

Position : Chr3 ( 5`- 5454818 .. 5455927 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16080

Protein [Map View]
MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTGFRE
GTEAKPRSKASASSA*

DNA
ATGGGAAAGGGAACAGGGAGTTTCGGTAAGAGGAGGAACAAGAGTCACACACTCTGTGTGAGATGTGGTCGTCGTAGTTT
CCACATCCAGAAGAGTCGTTGCTCGGCTTGTGCTTACCCAGCTGCTCGCAAGAGGACTTACAACTGGAGTGTGAAGGCCA
TCAGGAGGAAGACTACTGGTACCGGAAGGATGAGGTATCTCCGTAATGTTCCTCGTCGGTTCAAGACTGGATTCAGAGAA
GGTACTGAAGCCAAGCCAAGGAGCAAGGCATCAGCTTCATCAGCTTAA