Details for Arabidopsis Locus AT3G16070

Position : Chr3 ( 5`- 5451864 .. 5452316 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16070

Protein [Map View]
MFQKTNSFFHRTLHSLKSIIIRAGKKLPRPKTHFSCTFCRSNSLDGDNIYASFLNIWESDLENSIEGPLKLEHKVQEQEQ
YHQVKKTEACSSYSSRDCDTMEKKINEMYMTETVDIEQALDVEEALHYYSRISSPVYLNIVDKFFTDLYS*

DNA
ATGTTTCAGAAAACAAACAGTTTCTTTCATAGAACACTTCACAGTCTCAAGTCCATTATTATCCGAGCAGGTAAGAAACT
TCCTAGACCAAAAACTCACTTCTCCTGCACATTTTGCAGATCAAATTCTCTCGATGGCGACAATATCTACGCAAGTTTCC
TCAACATCTGGGAGTCTGATCTAGAAAACAGCATTGAAGGTCCATTAAAGTTGGAGCACAAGGTTCAAGAGCAAGAACAA
TATCATCAAGTGAAGAAAACAGAAGCTTGCTCTTCGTATTCATCAAGAGACTGCGATACAATGGAGAAGAAGATTAACGA
GATGTATATGACTGAGACAGTAGATATAGAGCAAGCCCTTGACGTTGAAGAGGCACTTCACTACTATTCTCGTATTAGCA
GTCCCGTGTATCTCAACATTGTTGACAAGTTCTTCACGGATCTCTACTCTTGA