Details for Arabidopsis Locus AT3G16040

Position : Chr3 ( 5`- 5443091 .. 5443952 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16040

Protein [Map View]
MSSKQGGKLKPLKQPKSGKKEYDEHDMELMQKKKDEEKALKELRAKASQKGSFGGSGLKKSGKK*

DNA
ATGTCTTCCAAGCAAGGAGGGAAATTGAAGCCTTTGAAGCAGCCCAAGTCTGGTAAGAAGGAGTACGATGAGCACGATAT
GGAGTTAATGCAGAAAAAGAAGGATGAAGAGAAGGCACTTAAAGAACTCAGGGCCAAGGCTTCACAAAAAGGATCATTCG
GAGGCTCAGGACTTAAGAAAAGTGGGAAGAAATAA