Details for Arabidopsis Locus AT3G16030

Position : Chr3 ( 5`- 5439609 .. 5442802 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16030

Protein [Map View]
MWSNCIFLTLFTFYLFLGQSCCQTDTLLQGQYLKDGQELVSAFNIFKLKFFNFENSSNWYLGIWYNNFYLSGAVWIANRN
NPVLGRSGSLTVDSLGRLRILRGASSLLELSSTETTGNTTLKLLDSGNLQLQEMDSDGSMKRTLWQSFDYPTDTLLPGMK
LGFNVKTGKRWELTSWLGDTLPASGSFVFGMDDNITNRLTILWLGNVYWASGLWFKGGFSLEKLNTNGFIFSFVSTESEH
YFMYSGDENYGGPLFPRIRIDQQGSLQKINLDGVKKHVHCSPSVFGEELEYGCYQQNFRNCVPARYKEVTGSWDCSPFGF
GYTYTRKTYDLSYCSRFGYTFRETVSPSAENGFVFNEIGRRLSSYDCYVKCLQNCSCVAYASTNGDGTGCEIWNTDPTNE
NSASHHPRTIYIRIKGSKLAATWLVVVASLFLIIPVTWLIIYLVLRKFKIKGTNFVSESLKMISSQSCSLTNKRLSTLRV
GSTIDQEMLLLELGIERRRRGKRSARNNNNELQIFSFESVAFATDYFSDANKLGEGGFGPVYKGRLIDGEEVAIKRLSLA
SGQGLVEFKNEAMLIAKLQHTNLVKLLGCCVEKDEKMLIYEYMPNKSLDYFLFDPLRKIVLDWKLRFRIMEGIIQGLLYL
HKYSRLKVIHRDIKAGNILLDEDMNPKISDFGMARIFGAQESKANTKRVAGTFGYMSPEYFREGLFSAKSDVFSFGVLML
EIICGRKNNSFHHDSEGPLNLIVHVWNLFKENRVREVIDPSLGDSAVENPQVLRCVQVALLCVQQNADDRPSMLDVVSMI
YGDGNNALSLPKEPAFYDGPPRSSPEMEVEPPEMENVSANRVTITVMEAR*

DNA
ATGTGGTCAAATTGCATCTTTCTCACTCTTTTTACTTTTTATCTCTTCTTAGGACAATCATGCTGTCAAACAGATACCCT
ACTGCAGGGTCAGTACTTGAAAGATGGGCAAGAGCTCGTTTCAGCTTTCAATATCTTCAAACTCAAGTTTTTCAACTTCG
AGAATTCAAGCAACTGGTATCTTGGAATTTGGTACAACAATTTTTATCTTAGTGGTGCTGTTTGGATTGCTAACCGTAAC
AATCCAGTTTTGGGACGCTCTGGAAGCCTCACAGTGGACTCTCTTGGCCGATTGAGGATTTTAAGAGGAGCATCAAGCCT
GCTTGAGCTAAGCTCTACGGAAACCACAGGAAACACAACCCTTAAGCTGTTGGATTCTGGAAATCTTCAGCTCCAAGAGA
TGGATTCTGATGGATCGATGAAGCGGACGTTGTGGCAAAGTTTTGATTATCCAACAGATACTCTTCTTCCGGGGATGAAA
CTGGGTTTCAATGTCAAGACCGGAAAGAGATGGGAACTGACATCATGGCTAGGTGATACTTTACCCGCTTCTGGATCTTT
TGTCTTTGGGATGGATGATAATATTACAAACCGGTTGACCATCTTGTGGCTTGGTAACGTGTATTGGGCAAGTGGGCTCT
GGTTTAAGGGTGGCTTTTCGTTGGAGAAATTAAACACGAACGGTTTCATCTTCTCCTTCGTTTCAACCGAAAGTGAACAT
TATTTTATGTATTCAGGTGATGAGAACTATGGTGGACCATTATTTCCTAGGATAAGGATAGACCAACAAGGCAGTTTGCA
GAAAATTAACCTTGATGGAGTGAAAAAGCATGTCCATTGTTCTCCTTCTGTGTTTGGTGAAGAGCTTGAATATGGTTGTT
ACCAACAAAATTTCAGGAATTGTGTGCCCGCACGTTACAAAGAGGTAACCGGGAGTTGGGATTGTTCGCCGTTTGGGTTT
GGTTACACTTACACCAGGAAGACATACGATTTGAGTTATTGCTCGCGCTTTGGTTATACTTTCAGAGAGACTGTATCCCC
TTCCGCAGAAAATGGATTTGTATTCAATGAGATTGGTAGAAGATTAAGCTCATATGATTGCTATGTTAAGTGTCTCCAAA
ATTGTTCTTGTGTTGCCTATGCTTCAACCAATGGGGATGGTACGGGCTGCGAGATCTGGAATACAGATCCTACCAACGAA
AATTCAGCTTCTCATCATCCCAGAACTATATATATTCGTATTAAAGGTTCAAAACTCGCGGCAACTTGGTTAGTTGTTGT
GGCATCACTATTTCTAATAATACCTGTGACTTGGTTGATCATCTATCTTGTTTTGAGGAAATTTAAAATAAAGGGTACAA
ATTTTGTATCAGAATCACTCAAAATGATTTCTTCTCAATCATGTTCTCTTACTAACAAGAGGCTTTCAACACTGAGAGTT
GGTTCAACAATAGACCAAGAAATGCTACTACTTGAGTTGGGGATTGAAAGGAGACGCCGAGGCAAGAGAAGTGCAAGGAA
TAATAATAATGAGCTTCAGATCTTTAGCTTTGAAAGTGTCGCTTTTGCAACAGATTACTTCTCTGATGCAAACAAGCTCG
GTGAAGGAGGTTTTGGTCCTGTATATAAGGGGAGGCTAATAGATGGGGAGGAAGTGGCTATCAAAAGGCTATCATTAGCA
TCCGGGCAAGGATTAGTGGAGTTCAAGAACGAAGCTATGCTTATTGCAAAACTTCAACACACAAATCTTGTCAAGTTGCT
AGGATGCTGCGTCGAGAAGGATGAGAAAATGTTGATTTACGAATACATGCCCAACAAGAGCCTTGACTACTTCCTCTTTG
ATCCCTTGAGGAAAATTGTTCTGGATTGGAAGCTGCGGTTTAGGATCATGGAAGGGATAATTCAAGGGCTTTTGTACCTT
CATAAGTACTCGAGATTGAAAGTAATACACAGAGACATCAAAGCCGGCAACATTTTGCTGGACGAGGATATGAACCCCAA
AATATCTGATTTTGGAATGGCTCGGATATTTGGAGCCCAAGAATCCAAAGCCAACACGAAAAGAGTTGCTGGCACATTTG
GCTATATGTCTCCAGAGTACTTCAGAGAGGGATTATTCTCGGCGAAATCAGATGTGTTCAGCTTCGGGGTTCTAATGCTC
GAAATCATTTGTGGAAGGAAAAACAATAGCTTCCACCATGACTCAGAAGGACCTCTGAATCTCATAGTCCATGTGTGGAA
TCTGTTTAAAGAGAACCGAGTTCGCGAGGTGATTGATCCATCTTTGGGAGATTCTGCAGTTGAGAACCCTCAAGTGTTGA
GATGCGTTCAAGTTGCTCTGTTGTGTGTACAACAAAACGCAGACGATAGACCAAGTATGTTAGACGTTGTGTCCATGATA
TACGGTGATGGAAACAACGCTCTTTCTTTGCCTAAAGAGCCAGCTTTCTATGATGGTCCCCCGAGAAGCTCGCCGGAGAT
GGAAGTTGAGCCACCGGAGATGGAAAATGTATCGGCAAATAGAGTTACAATCACAGTGATGGAAGCAAGATGA