Details for Arabidopsis Locus AT3G16010

Position : Chr3 ( 5`- 5434014 .. 5436264 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16010

Protein [Map View]
MMYVSARSGSAKRSISSLPHLSQRFKQTENEIVQMFSVPNHEESEKPQEKWKLSRKDPSVRMLDERFIRIVKIFKWGPDA
EKALEVLKLKVDHRLVRSILEIDVEINVKIQFFKWAGKRRNFQHDCSTYMTLIRCLEEARLYGEMYRTIQEVVRNTYVSV
SPAVLSELVKALGRAKMVSKALSVFYQAKGRKCKPTSSTYNSVILMLMQEGQHEKVHEVYTEMCNEGDCFPDTITYSALI
SSYEKLGRNDSAIRLFDEMKDNCMQPTEKIYTTLLGIYFKVGKVEKALDLFEEMKRAGCSPTVYTYTELIKGLGKAGRVD
EAYGFYKDMLRDGLTPDVVFLNNLMNILGKVGRVEELTNVFSEMGMWRCTPTVVSYNTVIKALFESKAHVSEVSSWFDKM
KADSVSPSEFTYSILIDGYCKTNRVEKALLLLEEMDEKGFPPCPAAYCSLINALGKAKRYEAANELFKELKENFGNVSSR
VYAVMIKHFGKCGKLSEAVDLFNEMKNQGSGPDVYAYNALMSGMVKAGMINEANSLLRKMEENGCRADINSHNIILNGFA
RTGVPRRAIEMFETIKHSGIKPDGVTYNTLLGCFAHAGMFEEAARMMREMKDKGFEYDAITYSSILDAVGNVDHEKDDVS
SF*

DNA
ATGATGTATGTATCTGCTCGATCCGGTTCTGCGAAGCGAAGCATCTCAAGTCTACCTCATCTCTCTCAGAGATTTAAACA
AACAGAGAATGAGATTGTTCAAATGTTTAGTGTTCCGAATCATGAGGAATCTGAGAAGCCTCAAGAGAAGTGGAAATTAT
CTAGAAAGGATCCGTCAGTGCGGATGTTGGATGAGAGATTCATTAGGATAGTGAAAATCTTCAAATGGGGACCTGATGCT
GAGAAAGCTCTTGAGGTGCTTAAACTGAAAGTTGATCATCGATTAGTTCGTTCGATTCTTGAGATAGACGTTGAGATAAA
TGTCAAGATTCAGTTTTTCAAATGGGCTGGTAAAAGAAGAAACTTTCAGCATGATTGCTCCACTTACATGACCTTAATAC
GCTGCCTTGAAGAAGCTAGGCTTTATGGTGAAATGTATAGAACGATACAAGAAGTGGTCCGTAACACATATGTTAGCGTT
AGTCCAGCAGTACTCTCTGAGCTTGTGAAAGCATTGGGGCGAGCTAAGATGGTTAGTAAAGCTTTATCGGTTTTTTATCA
GGCAAAAGGACGCAAGTGTAAACCCACTTCGAGCACTTACAACTCGGTGATTCTAATGTTGATGCAAGAAGGACAGCACG
AGAAAGTCCATGAGGTTTATACTGAGATGTGTAACGAAGGTGACTGTTTTCCAGACACGATTACTTACTCTGCGCTTATA
TCCTCGTATGAAAAACTAGGTCGTAATGATTCTGCGATAAGGTTGTTTGATGAAATGAAGGATAACTGTATGCAGCCTAC
AGAGAAAATATACACCACGTTGTTGGGAATTTACTTTAAGGTGGGTAAAGTTGAGAAAGCTTTAGATCTTTTCGAGGAGA
TGAAACGAGCAGGTTGTTCACCAACAGTTTATACGTACACGGAACTGATAAAGGGACTTGGCAAAGCTGGGAGGGTAGAT
GAAGCATATGGCTTCTATAAAGACATGCTTAGAGATGGATTGACTCCTGATGTTGTGTTCTTAAACAATCTGATGAACAT
TTTAGGCAAAGTGGGTCGAGTGGAGGAGTTGACAAATGTCTTCAGTGAGATGGGAATGTGGAGATGTACACCCACTGTTG
TCTCATACAATACCGTGATTAAAGCTCTGTTTGAGTCAAAAGCACATGTTTCGGAAGTAAGCTCTTGGTTTGATAAGATG
AAAGCAGACAGTGTTTCCCCTAGTGAATTCACTTACTCAATCCTTATAGATGGTTATTGTAAAACGAATAGAGTAGAGAA
AGCTCTGTTGCTGCTTGAGGAGATGGATGAGAAAGGTTTTCCACCTTGTCCTGCAGCGTATTGCAGCCTCATAAACGCTC
TTGGAAAGGCGAAAAGATATGAAGCAGCGAATGAGCTATTTAAGGAACTAAAAGAAAACTTCGGCAATGTAAGTTCTCGA
GTATACGCTGTGATGATCAAACATTTTGGGAAATGCGGGAAGCTCAGCGAAGCTGTAGATCTCTTCAATGAGATGAAGAA
CCAAGGAAGTGGTCCCGATGTTTATGCCTACAACGCCCTCATGTCAGGAATGGTAAAGGCTGGTATGATCAACGAAGCTA
ATTCCTTGCTTAGAAAGATGGAAGAAAACGGTTGCAGGGCCGATATAAACTCGCATAATATCATCCTCAATGGATTTGCT
AGAACAGGTGTGCCGAGACGGGCTATAGAAATGTTTGAAACTATAAAGCATTCTGGTATTAAGCCTGATGGTGTCACTTA
TAATACTCTTCTTGGATGCTTTGCACATGCTGGAATGTTTGAGGAGGCTGCAAGAATGATGAGAGAGATGAAAGATAAAG
GCTTTGAGTATGATGCCATCACTTACTCATCTATACTTGACGCTGTTGGCAATGTGGATCATGAAAAAGATGATGTTTCA
TCTTTCTAA