Details for Arabidopsis Locus AT3G16000

Position : Chr3 ( 5`- 5430889 .. 5433817 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16000

Protein [Map View]
MGFLIGGSCFVPSVPLHSRFLSSPSSSSSSSPSSSQFGLLCSSNVAKFKRRRPTLASLNQEDGYEYDVASAKRRAFLLVG
ISVLPFLQLRSPALADERGNEIKTSKVDLETEVAVVSEGTSPNPFLALLNGLGIFSAGVLGALYALARQDTKAAEETIES
LKNQLKDRERALVLKEKDFEAKLQHEQEERKKEVEKAKEEQLSLINQLNSAKDLVTELGRELSSEKKLCEKLKDQIESLE
NSLSKAGEDKEALETKLREKLDLVEGLQDRINLLSLELKDSEEKAQRFNASLAKKEAELKELNSIYTQTSRDLAEAKLEI
KQQKEELIRTQSELDSKNSAIEELNTRITTLVAEKESYIQKLDSISKDYSALKLTSETQAAADAELISRKEQEIQQLNEN
LDRALDDVNKSKDKVADLTEKYEDSKRMLDIELTTVKNLRHELEGTKKTLQASRDRVSDLETMLDESRALCSKLESELAI
VHEEWKEAKERYERNLDAEKQKNEISASELALEKDLRRRVKDELEGVTHELKESSVKNQSLQKELVEIYKKVETSNKELE
EEKKTVLSLNKEVKGMEKQILMEREARKSLETDLEEAVKSLDEMNKNTSILSRELEKVNTHASNLEDEKEVLQRSLGEAK
NASKEAKENVEDAHILVMSLGKEREVLEKKVKKLEEDLGSAKGEILRMRSQPDSVKAVNSTDNKEKSDNTVTVKKVVRRR
KSSTSS*

DNA
ATGGGTTTCCTGATAGGGGGCTCTTGCTTCGTCCCTTCTGTTCCTCTACACTCTCGATTCCTTTCATCTCCTTCTTCTTC
TTCTTCTTCTTCTCCTTCTTCGTCTCAGTTTGGGCTTCTGTGTTCGAGTAATGTCGCCAAGTTCAAGCGCCGACGACCAA
CATTGGCTTCTTTAAACCAGGAAGATGGGTACGAGTATGACGTTGCTTCCGCCAAAAGGAGGGCTTTCCTTCTTGTGGGT
ATCTCTGTTCTTCCCTTTTTGCAGCTTCGATCACCCGCTTTGGCTGATGAAAGAGGCAATGAGATAAAGACATCGAAGGT
TGATCTAGAAACTGAGGTTGCAGTAGTTAGTGAAGGAACATCCCCAAATCCATTTCTGGCTCTCCTGAATGGTCTTGGAA
TTTTTAGTGCTGGCGTTCTTGGTGCACTTTATGCACTGGCTCGGCAAGATACAAAAGCTGCTGAGGAAACCATCGAATCT
CTAAAGAACCAGTTGAAAGACAGAGAAAGAGCATTGGTTTTGAAGGAGAAAGATTTCGAGGCAAAACTGCAGCATGAGCA
GGAAGAGCGGAAAAAGGAAGTAGAAAAGGCAAAAGAGGAACAGTTGTCATTGATCAACCAGTTGAATTCTGCAAAGGACT
TGGTGACAGAATTAGGCCGGGAGCTAAGTAGCGAGAAGAAATTATGTGAGAAGCTTAAAGATCAAATCGAAAGTCTGGAA
AATAGTCTGTCAAAGGCTGGCGAAGACAAAGAGGCACTAGAAACAAAGCTCAGAGAAAAGCTTGATTTGGTTGAAGGACT
ACAAGATCGGATCAACTTGCTTAGTTTGGAGCTGAAAGATAGTGAAGAAAAAGCTCAACGTTTTAATGCATCGTTGGCAA
AAAAGGAAGCAGAATTGAAGGAACTCAACTCTATTTACACTCAAACTAGCCGAGATCTTGCTGAAGCGAAGTTAGAGATC
AAACAGCAGAAGGAAGAACTCATAAGAACTCAGAGTGAATTGGACTCGAAGAACTCTGCGATTGAGGAGTTAAACACAAG
AATAACAACTTTAGTGGCTGAGAAAGAGAGTTATATCCAGAAGCTTGATAGTATTTCAAAAGATTATAGTGCTTTGAAAT
TGACTTCTGAGACGCAAGCAGCTGCAGATGCAGAGCTCATCAGCAGGAAAGAGCAGGAGATTCAGCAGCTAAATGAAAAT
CTGGATCGTGCGCTAGATGATGTTAATAAAAGTAAAGACAAAGTTGCTGACTTAACTGAGAAGTACGAAGACTCGAAGAG
AATGCTGGATATAGAACTGACTACAGTAAAAAATTTGAGACATGAACTTGAAGGAACAAAGAAAACACTGCAGGCATCTA
GAGATCGGGTCTCTGACCTGGAAACGATGCTTGATGAGTCAAGAGCTTTGTGTTCAAAGTTAGAATCAGAGCTTGCTATA
GTTCACGAAGAATGGAAGGAAGCTAAGGAAAGATATGAAAGGAACCTCGATGCTGAAAAACAAAAGAATGAGATTTCTGC
TAGCGAACTTGCACTGGAGAAAGATCTTCGGAGGAGAGTTAAAGACGAGCTTGAGGGAGTAACTCATGAACTCAAAGAGT
CTTCTGTCAAGAACCAGAGCCTCCAGAAGGAACTTGTGGAGATTTACAAGAAAGTTGAAACCAGTAACAAGGAATTGGAA
GAGGAGAAAAAGACTGTTTTGTCGTTGAACAAAGAGGTGAAAGGAATGGAAAAGCAGATCTTGATGGAAAGGGAGGCGAG
AAAATCCCTTGAAACAGATCTCGAAGAAGCTGTAAAGTCTTTAGATGAGATGAACAAGAACACATCAATACTGTCACGAG
AGCTTGAGAAGGTGAATACCCATGCTTCAAACTTGGAGGACGAGAAAGAAGTACTTCAACGATCACTAGGAGAGGCAAAG
AATGCATCAAAAGAAGCTAAGGAAAATGTGGAAGATGCACATATCCTCGTGATGAGTCTAGGAAAAGAAAGGGAAGTGCT
AGAGAAGAAAGTGAAGAAGCTCGAGGAGGACTTGGGCTCTGCAAAGGGCGAGATACTGCGCATGAGGAGCCAACCGGATT
CTGTAAAAGCTGTGAATAGTACAGACAACAAAGAGAAGAGCGACAACACGGTTACTGTGAAGAAAGTTGTCAGGAGGAGA
AAGAGCAGTACCAGTTCTTGA