Details for Arabidopsis Locus AT3G15980

Position : Chr3 ( 5`- 5411292 .. 5418541 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15980

Protein [Map View]
MPLRLDIKRKFAQRSERVKSVDLHPTEPWILASLYSGTVCIWNYQTQTITKSFEVTELPVRSAKFIPRKQWVVAGADDMY
IRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDMLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTFAS
ASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPE
LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVASMDSSGKIIWAKHN
EIQTANIKSIGAGYELSSLYLRLLMEKDFPCLLKSWGPVIFIHNYSNSQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRS
FGSGLEFVWSSEGECAVRESSSKIKIFSKNFQERKSIRPTFSAEKIFGGTLLAMCSNDFICFYDWAECRLIQQIDVTVKN
LYWAESGDLVAIASDTSFYILKYNRELVSSHFDSGRPTDEEGVEDAFEVLHENDERVRTGIWVGDCFIYNNSSWKLNYCV
GGEVTTMYHLDRPMYLLGYIANQSRVYLVDKEFNVIGYTLLLSLIEYKTLVMRGDLDRANQILPTIPKEQHNNVAHFLES
RGMIEDALEIATDPDYKFDLAIQLGRLEIAKEIAEEVQSESKWKQLGELAMSSGKLQLAEDCMKYAMDLSGLLLLYSSLG
DAEGVSKLACLAKEQGKNNVAFLCLFTLGRLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVALWREDLSKVNPKAAES
LADPEEYSNLFEDWQVALSVEANTAETRGVYTAAENYPSHADKPSITLVEAFRNLQVEAEESLENGNIDHEVAEENGHVE
NEGDEEEQQEEEVNEEEGVVDADSTDGAVLVNGSEGEEEWGTNNKGNPSA*

DNA
ATGCCTCTCAGACTAGATATCAAGAGAAAGTTTGCTCAACGATCAGAGAGAGTCAAATCTGTTGATCTGCATCCTACTGA
ACCATGGATTCTAGCAAGTTTGTATTCTGGAACCGTGTGTATTTGGAACTACCAGACACAGACGATTACAAAATCCTTCG
AGGTGACGGAATTGCCAGTTAGGTCGGCCAAGTTTATTCCGCGCAAGCAATGGGTTGTGGCTGGAGCGGATGATATGTAC
ATCCGTGTATACAATTACAATACAATGGACAAGGTCAAAGTATTTGAGGCTCATTCGGATTACATTAGGTGTGTAGCTGT
CCATCCGACCCTTCCATATGTGCTGTCATCTTCTGATGATATGCTCATAAAGCTTTGGGACTGGGAAAACGGTTGGGCTT
GTACTCAGATATTTGAGGGACATTCGCACTATGTGATGCAAGTGGTATTTAATCCAAAAGATACCAACACTTTTGCCAGT
GCTTCGCTTGATCGTACCATAAAGATATGGAATCTTGGTTCCCCAGACCCAAATTTTACACTGGATGCTCATCAGAAAGG
AGTCAACTGTGTAGATTATTTCACAGGGGGTGATAAACCCTATCTAATTACCGGCTCTGATGATCATACTGCTAAGGTAT
GGGACTATCAAACCAAAAGTTGTGTCCAGACGCTAGATGGGCACACACACAATGTTTCTGCCGTATGTTTCCATCCAGAG
CTTCCAATAATAATCACAGGTTCTGAGGATGGCACTGTTCGCATTTGGCACGCCACTACCTACAGGCTAGAAAACACATT
AAATTATGGTCTCGAGAGAGTTTGGGCCATTGGTTACATCAAAAGTTCTCGGCGGGTTGTGATTGGATATGATGAAGGAA
CCATCATGGTTAAACTTGGACGAGAAATTCCTGTCGCTAGCATGGACAGTAGCGGAAAAATCATATGGGCTAAGCATAAT
GAAATTCAAACCGCAAACATCAAAAGTATTGGTGCAGGTTACGAGCTTTCATCTCTCTACCTTAGGCTACTGATGGAGAA
AGACTTCCCTTGTCTGTTAAAGAGTTGGGGACCTGTGATCTTTATCCACAACTATTCTAACTCTCAGAGCTTGAAGCACA
ACCCTAATGGGAGGTTTGTCGTAGTCTGCGGTGATGGAGAGTACATAATCTACACTGCTTTGGCGTGGAGAAATAGATCT
TTTGGGTCTGGCCTGGAATTTGTTTGGTCATCTGAGGGGGAATGTGCGGTTAGAGAAAGCTCATCAAAGATAAAGATATT
CAGTAAAAATTTCCAGGAAAGGAAGAGTATCCGGCCTACTTTCTCAGCTGAGAAGATTTTTGGAGGAACCTTGTTAGCAA
TGTGTTCGAATGATTTCATCTGCTTCTATGATTGGGCCGAATGCAGGCTGATTCAACAAATTGATGTCACCGTAAAGAAT
CTTTATTGGGCTGAAAGTGGTGATTTAGTAGCCATTGCTAGTGATACGTCATTCTACATCTTGAAGTACAATCGAGAGTT
GGTTTCCTCGCATTTTGATAGTGGAAGACCAACTGATGAAGAGGGTGTTGAGGATGCTTTTGAGGTTCTCCACGAGAATG
ATGAACGTGTTAGGACCGGTATATGGGTTGGGGACTGCTTCATTTACAACAACTCTTCTTGGAAGCTTAACTATTGTGTT
GGAGGCGAGGTAACCACAATGTATCATTTGGACCGCCCAATGTATTTGTTAGGCTATATTGCCAACCAAAGCCGGGTTTA
CTTGGTAGACAAAGAATTCAATGTCATAGGATATACCCTGCTGCTTAGCCTGATTGAATACAAGACTCTTGTGATGCGAG
GCGATTTGGATAGAGCCAATCAAATTTTACCTACAATTCCTAAAGAGCAGCATAACAATGTTGCTCATTTCTTGGAATCT
CGGGGAATGATTGAAGATGCTTTAGAAATTGCGACAGATCCAGACTACAAATTTGATCTGGCCATACAACTGGGTAGACT
TGAAATTGCAAAGGAAATTGCTGAAGAAGTACAGAGCGAGTCTAAATGGAAGCAGTTAGGAGAGTTAGCCATGTCCTCGG
GGAAGCTGCAATTGGCCGAGGATTGCATGAAGTACGCTATGGATTTGAGTGGTTTGTTACTACTATATTCTTCTTTGGGA
GATGCTGAAGGGGTGTCAAAACTTGCATGCCTTGCTAAGGAACAGGGGAAGAACAATGTTGCCTTTCTTTGCTTATTTAC
GCTGGGTAGATTGGAAGATTGTCTGCAGTTATTGGTGGAGAGTAACCGGATACCAGAAGCTGCTCTGATGGCACGTTCTT
ATCTTCCAAGCAAAGTTTCGGAGATAGTAGCTCTATGGAGGGAAGATCTCAGCAAGGTTAATCCAAAAGCAGCTGAATCT
TTAGCTGATCCTGAAGAGTACTCAAATCTTTTTGAGGATTGGCAAGTTGCTCTTTCTGTTGAAGCGAACACTGCAGAGAC
AAGGGGAGTTTATACCGCTGCAGAAAATTATCCATCCCATGCCGATAAACCTTCCATTACCCTTGTGGAAGCCTTTAGAA
ACCTGCAAGTTGAAGCAGAGGAATCACTTGAAAATGGAAACATCGATCACGAGGTAGCAGAAGAAAACGGTCATGTAGAG
AATGAAGGAGATGAAGAGGAACAACAGGAAGAAGAAGTGAATGAAGAAGAGGGAGTTGTGGATGCAGACTCTACGGACGG
TGCTGTACTTGTTAATGGAAGTGAGGGTGAGGAAGAGTGGGGTACGAATAACAAAGGAAACCCATCAGCCTAA