Details for Arabidopsis Locus AT3G15880

Position : Chr3 ( 5`- 5364081 .. 5372293 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15880

Protein [Map View]
MSSLSRELVFLILQFLDEEKFKDTVHRLEKESGFFFNMRYFEDSVTAGEWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQK
YLEALDKKDHAKAVDILVKELKVFSTFNEELFKEITMLLTLTNFRENEQLSKYGDTKSARGIMLGELKKLIEANPLFRDK
LQFPSLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHTCGHPNGAHTPSPTTNHLMGSVPKVGGFPPLGAHGPFQ
PTPAPLTTSLAGWMPNPSVQHPTVSAGPIGLGAPNSAVSMLKRERPRSPPTNSLSMDYQTADSESVLKRPRPFGISDGVN
NLPVNVLPVTYPGQSHAHATYSTDDLPKNVSRILSQGSAIKSMDFHPVQQTMLLVGTNLGDIAIWEVGSREKLVSRSFKV
WDLATCTVNLQASLASEYTAAVNRVVWSPDGGLLGVAYSKHIVHIYSYHGGEDLRNHLEIDAHAGNVNDLAFSQPNQQLC
VVTCGEDKTIKVWDAVTGNKLHTFEGHEAPVYSVCPHQKENIQFIFSTAVDGKIKAWLYDNMGSRVDYDAPGRSCTSMAY
CADGTRLFSCGTSKEGESFIVEWNESEGAVKRTYLGLGKRSVGVVQFDTMKNKFLVAGDEFQVKFWDMDSVDLLSSTAAE
GGLPSSPCLRINKEGTLLAVSTTDNGIKILANAEGSRILHSMANRGLDSSRAPPGSVAKGPIVGTFGTPNSSTGMSLSMG
ERSGPVASVTGLNGDNRSLPDVKPRIADDAEKSKTWKLTEISERSQLRTLRLPDTLLPARVVKLIYTNSGGAILALAENA
AHKLWKWQKSERNLLGKANSNVPPQLWQPSSGVLMTNDTREGNKEDVVPCFALSKNDSYVMSASGGKISLFNMMTFKTMT
TFMAPPPAATSLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADSQLCVWSMDG
WEKQASKQIQIPSGHSPNPLAHTRVQFHQDQIHVLVVHASQLAIYEAPKLENMKQWIPKESSGSVTDAVYSCDSQSIYAA
FDDGSVSILTATTLQLKCRIGPNSYLPSNPSSRVYPATVAAHPSEPNQFAVGLTDGGVHVIEPPGPEGKWGISAPPENGA
GPSVSSAPGSDQQPSDS*

DNA
ATGTCGTCACTCAGCAGAGAACTCGTGTTTTTAATACTTCAGTTTCTCGATGAAGAGAAATTCAAAGATACTGTTCACAG
GTTGGAGAAAGAGTCTGGTTTTTTCTTCAACATGAGGTACTTTGAAGATAGTGTAACAGCTGGTGAATGGGATGATGTAG
AGAAGTATCTTTCTGGATTCACTAAAGTTGATGATAATAGATACTCTATGAAAATATTTTTCGAGATTCGGAAGCAGAAG
TACCTTGAAGCACTTGACAAGAAAGATCATGCCAAGGCGGTTGATATTCTTGTTAAGGAGTTGAAAGTGTTCTCGACATT
CAACGAAGAGCTTTTTAAGGAGATTACCATGCTTTTAACCTTGACTAACTTCAGGGAAAATGAGCAGCTTTCCAAGTATG
GAGATACTAAGTCCGCAAGAGGTATCATGCTTGGGGAACTTAAAAAACTGATTGAAGCAAATCCTCTCTTCCGAGACAAA
CTTCAATTTCCCAGTTTGAAGAATTCTAGATTGAGAACCTTAATAAATCAAAGTTTGAACTGGCAACATCAGCTTTGCAA
GAATCCTAGGCCTAACCCGGATATAAAAACACTATTTGTTGACCATACGTGTGGGCATCCCAATGGTGCACACACTCCTT
CCCCTACAACTAATCATTTAATGGGTTCAGTCCCTAAAGTTGGAGGCTTCCCACCATTAGGTGCTCACGGTCCATTTCAG
CCAACACCAGCTCCTCTTACAACATCTCTTGCAGGATGGATGCCTAATCCATCGGTACAACACCCTACTGTTTCCGCTGG
GCCTATCGGCTTAGGTGCCCCCAACAGTGCTGTGTCTATGTTAAAGCGTGAGCGTCCCAGGAGTCCTCCAACTAATAGCC
TATCAATGGATTATCAGACGGCAGATTCTGAAAGTGTGTTGAAGAGACCCAGACCTTTTGGTATTTCAGATGGGGTTAAT
AATCTTCCAGTCAATGTCTTGCCAGTCACATATCCAGGGCAAAGCCATGCTCATGCAACTTATTCTACTGATGACTTGCC
CAAAAACGTTAGCAGGATTTTGAGTCAGGGTTCTGCCATTAAGAGCATGGATTTTCATCCAGTACAGCAAACTATGCTCC
TTGTTGGCACCAATCTTGGTGATATTGCAATATGGGAGGTGGGTAGCAGGGAGAAGCTCGTTTCTAGAAGCTTTAAAGTT
TGGGATCTTGCTACTTGCACTGTGAACCTTCAGGCTTCACTTGCTAGCGAGTATACTGCAGCAGTAAACCGAGTTGTTTG
GAGTCCTGATGGAGGTCTACTGGGTGTCGCATATTCCAAGCATATTGTGCATATATATTCATATCATGGTGGCGAGGATT
TACGGAATCATCTAGAGATTGATGCCCATGCTGGTAATGTCAACGATCTTGCTTTCTCCCAACCAAACCAGCAATTATGT
GTTGTGACTTGTGGAGAAGACAAGACAATCAAGGTCTGGGATGCTGTTACCGGAAATAAATTGCACACTTTTGAAGGTCA
TGAGGCACCTGTTTATTCCGTGTGCCCACACCAGAAAGAGAATATTCAGTTCATATTCTCAACTGCTGTTGATGGGAAAA
TAAAGGCTTGGTTATATGACAACATGGGTTCTAGAGTGGATTATGATGCCCCCGGTCGATCTTGCACGTCGATGGCATAT
TGTGCTGATGGGACTAGATTATTTTCTTGTGGTACTAGTAAGGAGGGGGAGTCATTCATTGTTGAATGGAATGAAAGTGA
AGGAGCTGTGAAGCGGACTTATCTTGGACTGGGGAAACGGTCTGTGGGGGTTGTCCAGTTCGACACCATGAAGAATAAAT
TTTTGGTAGCTGGTGATGAATTCCAAGTCAAATTTTGGGATATGGATAGTGTTGATCTCTTGAGTTCAACGGCTGCAGAA
GGGGGTTTACCGTCTTCCCCTTGCTTAAGGATCAATAAAGAAGGAACTCTGCTGGCCGTCTCAACTACTGATAACGGAAT
TAAGATTCTAGCGAATGCTGAAGGTTCCAGAATTTTGCATTCCATGGCAAACCGTGGCCTTGATAGCTCTAGAGCTCCTC
CTGGGTCAGTTGCTAAGGGTCCTATTGTTGGCACATTTGGCACTCCAAATTCAAGCACTGGAATGAGTCTATCAATGGGT
GAAAGAAGTGGACCAGTGGCATCTGTTACTGGATTGAATGGAGATAATCGCAGTCTGCCAGATGTCAAACCACGAATCGC
TGATGATGCAGAGAAATCAAAGACTTGGAAGCTGACTGAGATCAGTGAACGTTCCCAGCTTCGTACTCTGCGGCTTCCTG
ACACCCTGCTACCAGCAAGAGTTGTTAAGTTGATATATACAAATTCTGGAGGTGCTATATTGGCATTAGCAGAAAATGCT
GCACATAAACTATGGAAATGGCAAAAGAGTGAGCGGAATCTTTTGGGAAAGGCAAACAGCAATGTCCCACCACAGCTTTG
GCAGCCATCTAGTGGAGTATTAATGACAAATGATACACGTGAGGGAAACAAAGAGGATGTAGTTCCATGCTTTGCACTCT
CAAAAAATGATTCTTATGTCATGTCAGCCTCTGGAGGAAAAATTTCCTTATTCAACATGATGACTTTTAAGACGATGACG
ACATTCATGGCTCCTCCTCCAGCAGCGACTTCCCTTGCCTTCCATCCTCAAGACAATAATATAATTGCTATCGGAATGGA
TGACTCTTCTATTCAAATCTACAATGTCAGAGTTGATGAGGTTAAAAGTAAATTGAAAGGTCATCAGAAGAGAGTGACTG
GTTTAGCATTCTCAAACGTGCTAAATGTTCTTGTTTCCTCTGGTGCTGATTCTCAGCTTTGTGTATGGAGCATGGATGGA
TGGGAAAAACAAGCTAGCAAACAGATACAAATTCCAAGCGGGCATTCACCAAATCCACTTGCTCATACACGCGTTCAGTT
CCATCAAGACCAGATACATGTACTTGTTGTCCATGCCAGCCAGTTAGCCATATATGAGGCTCCTAAATTAGAGAACATGA
AGCAGTGGATACCGAAAGAGTCAAGTGGTTCAGTCACAGATGCAGTATATTCATGTGATAGCCAGTCAATCTATGCAGCC
TTTGATGATGGAAGTGTGAGTATCTTGACGGCAACAACATTGCAACTGAAGTGCCGCATTGGTCCCAATTCATATTTGCC
TTCAAACCCGAGCTCGAGAGTATATCCAGCCACAGTTGCAGCACATCCGTCTGAACCAAACCAGTTTGCAGTTGGACTAA
CCGATGGTGGGGTCCACGTGATCGAACCACCAGGTCCAGAAGGGAAGTGGGGAATATCCGCACCACCAGAAAACGGAGCA
GGGCCAAGCGTCTCCTCAGCTCCCGGGTCAGATCAACAACCGAGTGATTCGTAG