Details for Arabidopsis Locus AT3G15860

Position : Chr3 ( 5`- 5361207 .. 5361719 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15860

Protein [Map View]
MDLNNNKSNNIVKTLARWCLLLQAFMISSNTVALKEPDYVNMNITIRNSMTGLIRPEIVYRCQSKRKDYGWHRSPKPGVQ
FSFPIILIKGETKIPAIHICQIRSVLGTATLVIQNTYLDAEMCPRSSCAHEATPKGIVFRGLEWDFKTVFPKLKPVEYLE
LPWTPWPNRT*

DNA
ATGGATCTAAACAACAACAAGAGCAACAACATCGTCAAAACCCTAGCTCGATGGTGTCTTCTTTTACAAGCTTTCATGAT
CTCGTCCAACACCGTGGCTCTTAAGGAACCAGACTACGTAAACATGAACATAACAATCCGTAACTCAATGACGGGATTAA
TCCGCCCGGAAATCGTGTATCGATGCCAATCTAAACGCAAAGACTATGGTTGGCATCGATCTCCAAAGCCAGGAGTCCAA
TTTTCATTCCCAATCATCCTCATAAAAGGCGAAACCAAAATACCAGCGATTCACATCTGCCAAATCCGGTCCGTGTTAGG
AACGGCTACACTCGTGATCCAAAACACCTATCTGGACGCTGAGATGTGCCCTAGATCGTCGTGTGCTCACGAGGCAACCC
CGAAAGGAATTGTGTTTAGAGGCCTTGAGTGGGATTTCAAAACCGTGTTTCCTAAACTCAAACCAGTTGAGTATCTAGAA
TTGCCGTGGACACCTTGGCCAAACAGAACGTAA