Details for Arabidopsis Locus AT3G15850

Position : Chr3 ( 5`- 5359009 .. 5361185 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15850

Protein [Map View]
MASLLTKPKPVFLCSPSLSPRTLNTATPSLNFTRISFTHHQKLAPFKPPSLVVAFSEKGLKRDVTTAAAATEGDYRRIML
SDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPK
WLEYLFAYCGAQALQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRF
LRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDLSKNNWWVAALAFGEGWHNNH
HAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSEAQKQRMAFTSD*

DNA
ATGGCTTCTCTTCTAACAAAACCCAAACCCGTTTTCCTCTGTTCACCATCGTTATCTCCAAGAACTTTGAACACAGCAAC
ACCGTCATTGAATTTCACCAGAATTTCATTCACCCATCACCAAAAGCTTGCTCCTTTCAAGCCTCCTAGTCTCGTTGTTG
CATTCTCTGAAAAGGGTTTGAAGAGAGATGTCACCACAGCTGCTGCAGCGACGGAGGGAGATTACAGAAGGATAATGTTA
TCTGATGTGTTGGTGAAGAAGAAGGAAAAAGTAGTTTGGTGGGAGAGAGAATGGAAAGCTATGGACTTTGGAGCTGTTGC
TGTCGTTTTGTCTATGCATTTGCTTAGTCTTTTGGCTCCGTTTCAATTCAATTGGAGAGCTGTTTCGGTTGCTTTTGGGC
TTTATATCGTTACAGGTCTTCTGGGGATTACTCTGTCTTTCCATAGGAATCTTTCTCATAAAGCCTTCAAGCTACCTAAA
TGGCTTGAGTACTTGTTTGCTTATTGTGGAGCTCAAGCTCTTCAGGGAAACCCAATTGATTGGGTGAGTACACATAGGTA
CCATCATCAGTTTTGTGATTCAGACAGAGACCCTCATAGCCCACTTGATGGGTTTTGGTTCAGTCACATGAATTGGATGT
TTGATACCAATACAATCACCCAAAGGTGTGGAGAGCCTAATAATGTTGGGGACTTGGAGAAGCAGCCATTCTATCGATTC
CTTCGAACCACCTACATTTTGCATCCGCTGGCTCTAGCGGTTGCTTTATACGCAATGGGTGGCTTTCCATTCATCGTTTG
GGGAATGGGTGTAAGAATAGTATGGGTATATCATATAACTTGGCTAGTGAACTCAGCTTGTCATGTATGGGGAAAACAAG
CATGGAACACAGGCGATTTGTCTAAGAACAACTGGTGGGTAGCAGCTCTAGCATTCGGGGAAGGATGGCACAACAATCAC
CATGCTTTTGAGTTCTCAGCTCGACACGGCTTAGAATGGTGGCAACTTGATATGACTTGGTACGTCGTTAAGTTCCTTCA
AGCCATCGGTTTAGCAACTGATGTCAAGCTCCCATCGGAAGCTCAGAAACAAAGAATGGCATTCACCAGCGACTGA