Details for Arabidopsis Locus AT3G15820

Position : Chr3 ( 5`- 5351071 .. 5353728 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15820

Protein [Map View]
MSAAAAETDVSLRRRSNSLNGNHTNGVAIDGTLDNNNRRVGDTNTHMDISAKKTDNGYANGVGGGGWRSKASFTTWTARD
IVYVVRYHWIPCMFAAGLLFFMGVEYTLQMIPARSEPFDLGFVVTRSLNRVLASSPDLNTVLAALNTVFVGMQTTYIVWT
WLVEGRARATIAALFMFTCRGILGYSTQLPLPQDFLGSGVDFPVGNVSFFLFFSGHVAGSMIASLDMRRMQRLRLAMVFD
ILNVLQSIRLLGTRGHYTIDLAVGVGAGILFDSLAGKYEEMMSKRHLGTGFSLISKDSLVN*

DNA
ATGTCAGCCGCCGCAGCTGAAACCGACGTCTCTCTCCGTCGCAGATCTAACTCTCTTAACGGAAACCACACTAACGGCGT
CGCCATTGACGGAACCCTAGACAACAACAACCGTCGCGTCGGAGATACAAACACTCACATGGATATATCTGCTAAGAAAA
CTGACAACGGCTACGCCAATGGTGTCGGAGGAGGAGGATGGAGAAGCAAAGCGTCGTTCACGACGTGGACGGCGCGTGAT
ATCGTCTACGTGGTGAGATACCATTGGATACCGTGCATGTTCGCTGCCGGACTTCTGTTCTTCATGGGCGTGGAGTACAC
GCTTCAGATGATTCCCGCGAGATCTGAGCCGTTCGATCTTGGGTTTGTGGTCACGCGCTCTTTGAATCGCGTATTAGCAT
CTTCACCGGATCTTAACACTGTTTTAGCCGCACTAAACACGGTGTTCGTAGGGATGCAAACAACGTATATTGTATGGACA
TGGTTAGTGGAAGGACGAGCACGAGCCACCATCGCGGCTTTATTCATGTTCACTTGTCGCGGCATTCTCGGCTACTCTAC
TCAGCTTCCTCTCCCTCAGGACTTTCTAGGATCAGGGGTTGATTTTCCGGTGGGAAATGTCTCTTTCTTCCTCTTCTTCT
CTGGCCATGTCGCCGGCTCGATGATCGCATCATTGGACATGAGAAGAATGCAGAGGTTGAGACTTGCAATGGTCTTTGAC
ATCCTCAATGTATTACAGTCGATCAGACTGCTCGGTACAAGAGGACATTACACAATCGACCTTGCGGTTGGAGTTGGCGC
TGGGATTCTCTTCGACTCATTGGCCGGAAAGTACGAAGAGATGATGAGCAAGAGACATTTAGGCACTGGTTTTAGTTTGA
TTTCGAAAGACTCTCTAGTCAATTAA