Details for Arabidopsis Locus AT3G15790

Position : Chr3 ( 5`- 5343016 .. 5344700 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15790

Protein [Map View]
MGGEEEVVSVELPAPSSWKKLFYPNKVGSVKKTEVVFVAPTGEEISNRKQLEQYLKSHPGNPAIAEFDWTTSGTPRRSAR
ISEKTKATPSPDKEPPKKRGRTKSPVSKKDAEGEKSEGGGEENSHVKDTEMNPPEGIAENENVTDKNGSGETERVNDAKE
NIVAEETPNAAPVQEEGESMKEKALDSVDDKSKETDKEKDTGSIEKNSVDVEKKTVEASDEKKNSEAETRNHEENGLTTE
AEGKEKTAEGEATG*

DNA
ATGGGTGGTGAAGAGGAAGTTGTTTCTGTTGAGCTACCAGCACCTTCTTCATGGAAGAAATTGTTTTACCCCAACAAAGT
GGGTTCAGTGAAGAAAACAGAGGTTGTGTTTGTGGCTCCAACGGGTGAGGAGATTAGTAACAGAAAGCAGCTGGAGCAGT
ATCTCAAATCGCACCCTGGAAACCCCGCGATCGCAGAGTTTGATTGGACGACTAGTGGGACACCTAGGAGATCTGCAAGA
ATCAGTGAGAAGACTAAGGCTACGCCGTCACCAGATAAAGAGCCACCCAAGAAGCGAGGTAGAACCAAATCTCCAGTGTC
AAAGAAAGATGCAGAAGGTGAGAAATCAGAGGGAGGAGGAGAGGAAAACTCTCATGTGAAAGATACTGAAATGAATCCTC
CAGAGGGAATCGCCGAGAATGAAAATGTGACCGATAAGAATGGCTCCGGTGAAACTGAGAGGGTGAATGATGCAAAAGAA
AACATTGTTGCTGAGGAAACTCCAAATGCGGCTCCAGTTCAAGAAGAGGGTGAGTCGATGAAGGAGAAAGCTCTGGATTC
TGTTGATGATAAGAGTAAGGAGACTGACAAAGAAAAAGATACTGGCTCAATCGAAAAGAACTCGGTAGATGTAGAGAAGA
AGACCGTTGAAGCTAGTGATGAGAAGAAGAATTCTGAAGCTGAGACCAGAAACCATGAAGAAAATGGTCTGACCACAGAA
GCTGAGGGGAAAGAGAAAACAGCAGAAGGAGAAGCTACCGGATAG