Details for Arabidopsis Locus AT3G15780

Position : Chr3 ( 5`- 5341426 .. 5342557 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15780

Protein [Map View]
MAMALSNPTTSTNLYHYSILSPFSPPYHLHRRNTVLLASPRRLRRLAVAGGPPSPPGPDPPPPEDTTQLEGLVGAVTRVQ
DRVKIFLAVFFWMFLFFWVTVTDGTGKGKGKKGSRFK*

DNA
ATGGCGATGGCTTTGTCCAACCCGACCACAAGCACTAACCTCTACCACTACTCAATTCTCTCGCCGTTCTCACCGCCGTA
TCACCTTCACCGTCGAAACACCGTCCTACTAGCGAGTCCCCGCCGTTTACGCCGCCTCGCCGTCGCTGGTGGTCCTCCTT
CTCCTCCAGGCCCTGATCCGCCTCCGCCTGAGGACACCACTCAGCTAGAAGGTCTTGTGGGAGCTGTGACAAGGGTTCAA
GACCGCGTAAAGATTTTCCTCGCAGTGTTCTTTTGGATGTTTCTCTTCTTCTGGGTTACAGTCACAGATGGGACGGGTAA
AGGCAAAGGCAAGAAGGGTTCACGTTTCAAGTAG