Details for Arabidopsis Locus AT3G15770

Position : Chr3 ( 5`- 5340074 .. 5341339 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15770

Protein [Map View]
MGSSCLACFDKSKAKTSVDVPLNGTKDVLVEEDWSELRKPSVVASEDFWTNTTLDMESNAHGSVSSISTTNLTIDSQGCG
SSSNEPAEFVNHGLVLWNQTRQQWVGDKRSESRKSVGREPILNENVTYESLLGSNKRFPRPIPLDEMVQFLVEVWEEEGL
YG*

DNA
ATGGGCAGTAGTTGTTTGGCTTGTTTTGATAAGTCGAAAGCAAAAACAAGTGTAGATGTGCCTTTGAATGGCACAAAAGA
TGTGTTAGTAGAAGAAGATTGGAGTGAATTGAGGAAGCCTAGTGTAGTAGCTTCTGAAGATTTCTGGACTAATACCACTT
TAGATATGGAAAGCAATGCTCACGGAAGTGTTTCTTCAATCAGTACAACCAATCTGACTATTGATTCTCAAGGATGTGGT
TCCAGCTCTAATGAACCTGCTGAATTTGTTAACCATGGTCTTGTGCTATGGAATCAAACTCGGCAGCAATGGGTGGGAGA
TAAAAGATCCGAGAGCCGTAAAAGCGTTGGTCGAGAACCGATTCTAAATGAGAATGTGACTTATGAGAGTCTACTTGGGA
GCAACAAGCGATTTCCGAGGCCTATACCTCTTGATGAAATGGTGCAGTTTCTTGTTGAAGTTTGGGAAGAAGAAGGTCTA
TACGGCTAA