Details for Arabidopsis Locus AT3G15730

Position : Chr3 ( 5`- 5330322 .. 5333745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15730

Protein [Map View]
MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKARVGRTRKIKNEPKNPKWYESF
HIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGEEVDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMG
IKSAKFPGVPYTFFSQRQGCKVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEIALV
RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFRGSDVHCILCPRNPDDGGSIV
QSLQISTMFTHHQKIVVVDSEMPSRGGSEMRRIVSFVGGIDLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFTGAAITKGG
PREPWHDIHSRLEGPIAWDVMYNFEQRWSKQGGKDILVKLRDLSDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGFPE
SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYVENQYFLGSSFAWAADGITPEDINALHLIPKELSLKIVSKIE
KGEKFRVYVVVPMWPEGLPESGSVQAILDWQRRTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKDGEYEPAEK
PDPDTDYMRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLW
YEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILGTK
SDYLPPILTT*

DNA
ATGGCGCAGCATCTGTTGCACGGGACTTTACATGCTACCATCTATGAAGTTGATGCCCTCCATGGTGGTGGTGTTAGGCA
AGGCTTCCTTGGCAAGATTCTGGCAAATGTAGAAGAGACGATTGGTGTTGGTAAAGGAGAAACACAGTTGTATGCGACGA
TTGATCTGCAAAAAGCTAGAGTTGGGAGAACCAGGAAGATCAAAAATGAACCTAAGAACCCAAAGTGGTATGAGTCGTTT
CATATTTACTGTGCTCACTTGGCTTCTGATATCATCTTCACTGTTAAAGATGATAATCCCATTGGAGCTACCCTTATCGG
AAGAGCTTACATTCCTGTTGATCAAGTCATTAACGGCGAGGAAGTGGATCAGTGGGTTGAGATCTTGGATAATGACAGAA
ACCCTATTCAGGGAGGATCAAAGATTCATGTCAAGCTTCAATATTTCCATGTTGAGGAGGATCGTAACTGGAACATGGGT
ATCAAAAGTGCCAAGTTCCCTGGAGTGCCATACACATTCTTCTCGCAGAGACAAGGCTGCAAAGTTTCTCTGTACCAAGA
TGCTCATATTCCAGACAACTTTGTCCCTAGAATTCCTCTCGCTGGAGGGAAGAACTATGAGCCTCAAAGATGTTGGGAGG
ATATTTTTGATGCTATTAGCAATGCAAAACACTTGATCTACATTACTGGTTGGTCTGTTTACGCTGAGATTGCTTTAGTG
AGGGACTCGAGGAGGCCTAAGCCTGGAGGTGATGTGACCATTGGTGAGCTACTCAAGAAGAAGGCTAGTGAAGGTGTCAG
GGTTCTTTTGCTTGTTTGGGATGACAGAACTTCTGTTGATGTGCTGAAGAAAGATGGGCTCATGGCTACTCATGATGAAG
AGACCGAGAATTTCTTCAGGGGAAGTGATGTCCATTGTATTCTGTGCCCTCGTAACCCGGATGACGGTGGTAGCATAGTC
CAAAGTTTGCAGATCTCTACTATGTTCACGCATCATCAGAAAATCGTTGTTGTGGACAGCGAGATGCCAAGCAGAGGAGG
ATCAGAAATGAGGAGAATTGTGAGTTTTGTTGGCGGTATTGATCTTTGTGATGGAAGATACGACACTCCGTTCCACTCCT
TGTTCAGGACATTGGACACAGTCCACCATGATGACTTCCATCAACCTAACTTCACTGGTGCTGCTATCACTAAAGGTGGT
CCAAGGGAGCCTTGGCATGACATTCACTCCCGTCTTGAAGGTCCAATTGCTTGGGATGTCATGTACAACTTCGAGCAGAG
ATGGAGCAAGCAGGGTGGTAAAGACATTCTGGTTAAGTTGAGAGATCTTAGTGATATTATTATCACCCCTTCTCCTGTTA
TGTTCCAAGAGGACCACGATGTGTGGAATGTCCAATTGTTTAGGTCCATTGATGGAGGAGCTGCTGCTGGGTTTCCCGAG
TCGCCTGAAGCTGCTGCGGAAGCCGGGCTTGTAAGTGGGAAAGATAACATCATTGATAGGAGTATCCAAGATGCTTACAT
TCATGCAATCAGACGTGCTAAGGATTTCATCTACGTTGAAAACCAGTACTTCCTTGGGAGTTCTTTTGCTTGGGCAGCCG
ATGGTATTACTCCTGAGGACATCAATGCCCTGCACTTAATCCCAAAAGAGTTGTCGCTGAAGATAGTTAGCAAGATTGAG
AAAGGAGAGAAGTTCAGGGTCTATGTTGTGGTTCCAATGTGGCCAGAAGGTCTCCCAGAGAGTGGATCAGTGCAAGCTAT
ATTAGACTGGCAGAGGAGGACCATGGAGATGATGTACAAGGATGTGATTCAGGCTCTCAGGGCCCAGGGTCTTGAGGAAG
ATCCAAGAAACTATCTGACATTCTTCTGTCTTGGAAACCGTGAGGTCAAGAAAGATGGAGAGTATGAGCCTGCTGAGAAA
CCAGACCCCGACACTGATTACATGAGGGCGCAAGAAGCACGCCGTTTCATGATTTACGTCCACACCAAAATGATGATCGT
TGACGATGAATACATTATCATTGGGTCTGCTAACATCAACCAGAGGTCAATGGACGGTGCAAGAGACTCTGAGATAGCAA
TGGGAGGTTATCAACCACATCACTTGTCCCATAGACAACCAGCTCGTGGCCAGATCCATGGGTTTCGTATGTCACTCTGG
TACGAACACCTGGGAATGCTCGATGAAACCTTCCTCGATCCATCAAGCTTGGAATGCATTGAGAAAGTTAACCGCATTTC
TGACAAGTATTGGGACTTTTACTCAAGTGAGTCACTCGAACATGACCTTCCTGGTCACTTGCTCCGCTACCCGATCGGTG
TAGCCAGCGAAGGCGACATCACTGAGCTTCCAGGATTTGAATTCTTCCCGGACACAAAGGCCCGTATCCTCGGCACCAAA
TCAGACTACCTGCCTCCAATCCTTACAACCTAA