Details for Arabidopsis Locus AT3G15710

Position : Chr3 ( 5`- 5323358 .. 5324908 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15710

Protein [Map View]
MGFIGETVDSIKSIKIRQVLTQAITLGMIVTSALIIWKALICVTGSESPVVVVLSESMEPGFQRGDILFLRMTDEPIRAG
EIVVFSVDGREIPIVHRAIKVHERGDTKAVDVLTKGDNNDIDDIGLYAEGQLWLHRHHIMGRAVGFLPYVGWVTIIMTEK
PIIKYILIGALGLLVITSKD*

DNA
ATGGGTTTCATCGGAGAAACTGTAGATTCCATCAAATCTATCAAGATCCGTCAAGTTCTCACTCAGGCTATCACTCTCGG
TATGATCGTTACATCTGCATTGATAATTTGGAAGGCATTGATATGTGTCACTGGCAGTGAATCACCAGTGGTTGTTGTTC
TCTCTGAAAGTATGGAACCTGGCTTTCAGAGAGGAGATATATTGTTCTTGCGGATGACTGATGAGCCTATTCGAGCAGGC
GAGATTGTTGTGTTCAGTGTTGATGGTCGTGAAATTCCCATTGTTCATCGAGCAATCAAAGTTCATGAGAGAGGAGATAC
TAAAGCAGTTGATGTTCTAACAAAAGGTGACAACAATGACATTGATGACATTGGTCTCTATGCTGAAGGACAGCTTTGGC
TTCACAGGCATCATATCATGGGCAGAGCTGTTGGATTCTTGCCTTATGTTGGATGGGTTACTATTATCATGACAGAAAAG
CCTATCATCAAGTATATACTCATTGGTGCATTGGGTTTGCTCGTTATAACATCGAAAGACTAA