Details for Arabidopsis Locus AT3G15690

Position : Chr3 ( 5`- 5316916 .. 5319613 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15690

Protein [Map View]
MASCSLGVPKIKISAVDLSRVRSGSLLIPYNQRSLLRQRPVKYLSLKTTFGSVKAVQVSTVPTAETSATIEVKDSKEIKS
SRLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLYVARNIADNSSLQPPPTPAVTASNATTESPESNGSASSTSL
AISKPASSAADQGLMILQSPKVGFFRRSKTIKGKRLPSSCKEKDQVKEGQILCYIEQLGGQFPIESDVTGEVVKILREDG
EPVGYNDALISILPSFPGIKKLQ*

DNA
ATGGCTTCCTGTAGCCTAGGAGTTCCTAAAATTAAAATCTCGGCAGTAGACCTTAGTAGAGTAAGATCTGGAAGCTTACT
GATACCATACAATCAAAGATCATTGCTTCGACAAAGGCCAGTGAAGTACTTGAGTCTGAAGACAACATTTGGATCTGTGA
AAGCTGTCCAAGTGTCTACTGTCCCAACTGCAGAAACATCAGCTACTATAGAAGTAAAAGATTCTAAAGAGATCAAGTCA
TCTCGATTAAACGCTCAGCTTGTTCCCAAGCCTTCTGAGGTGGAAGCCCTTGTAACTGAAATATGCGATTCTTCATCAAT
TGCAGAGTTTGAACTGAAACTGGGGGGTTTCCGACTATATGTAGCAAGGAACATAGCTGACAATAGTAGTCTACAACCTC
CGCCAACTCCTGCTGTGACTGCTTCAAATGCAACTACCGAGAGTCCTGAGTCGAATGGATCAGCTTCCTCTACTTCACTG
GCTATCTCAAAACCAGCATCGTCAGCCGCTGATCAGGGTTTGATGATTCTCCAATCTCCAAAAGTAGGGTTCTTCAGGAG
ATCCAAAACCATAAAGGGTAAACGCCTGCCTTCGTCTTGTAAAGAGAAAGACCAAGTGAAAGAAGGTCAAATTCTGTGCT
ACATTGAACAACTCGGTGGCCAATTTCCAATCGAGTCTGATGTTACCGGCGAGGTAGTCAAGATACTCCGAGAAGATGGA
GAGCCTGTAGGATACAATGATGCTCTCATCTCCATCCTTCCATCCTTCCCTGGGATCAAGAAGCTTCAGTAA