Details for Arabidopsis Locus AT3G15680

Position : Chr3 ( 5`- 5315001 .. 5316466 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15680

Protein [Map View]
MSRPGDWNCRSCSHLNFQRRDSCQRCGDSRSGPGGVGGLDFGNFGGRAMSAFGFTTGSDVRPGDWYCTVGNCGTHNFASR
STCFKCGTFKDETGAGGGGGGIGGPAMFDADIMRSRVPGNGGRSSWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSN
RTSF*

DNA
ATGAGCAGACCCGGAGATTGGAACTGCAGGTCATGCAGCCATCTCAACTTCCAGCGCCGTGACTCTTGCCAGCGATGCGG
TGACTCTCGTTCCGGCCCCGGTGGAGTTGGTGGCTTAGACTTTGGTAATTTCGGTGGCAGAGCCATGTCTGCTTTCGGAT
TCACCACCGGCTCCGACGTTCGTCCCGGTGATTGGTACTGCACCGTGGGAAACTGCGGGACACACAACTTCGCCAGTCGC
TCCACCTGCTTCAAATGCGGCACTTTCAAGGACGAGACCGGCGCTGGAGGCGGAGGTGGTGGCATCGGCGGTCCGGCCAT
GTTTGACGCCGACATTATGCGGTCTAGAGTCCCCGGTAACGGTGGTCGCTCTAGCTGGAAATCCGGCGACTGGATTTGCA
CTAGGATTGGTTGCAATGAGCATAACTTTGCAAGCAGAATGGAATGCTTCAGGTGCAATGCACCAAGGGACTTCAGCAAC
AGAACCTCTTTCTAA