Details for Arabidopsis Locus AT3G15660

Position : Chr3 ( 5`- 5307944 .. 5309581 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15660

Protein [Map View]
MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPDSTDSLKDIVENDVKDNPVMI
YMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQK
LKDVSGNQD*

DNA
ATGGCGGCTTCTTTATCGAGCAGACTTATAAAAGGAATCGCTAATCTCAAAGCTGTTCGTTCTAGCAGATTGACGTCTGC
ATCAGTCTACCAAAATGGGATGATGAGATTTTCCTCAACAGTGCCAAGTGATTCAGATACACATGATGATTTCAAGCCTA
CACAAAAAGTCCCTCCCGATTCTACGGACTCACTTAAAGATATCGTTGAGAATGATGTGAAGGATAATCCTGTTATGATC
TACATGAAAGGTGTCCCTGAATCTCCTCAGTGTGGGTTTAGCTCACTAGCCGTCAGAGTTTTGCAGCAATATAATGTTCC
TATCAGTTCTAGAAACATTCTAGAAGACCAAGAGTTGAAAAACGCTGTGAAATCCTTCAGCCACTGGCCTACGTTTCCAC
AGATCTTCATTAAGGGAGAGTTCATTGGCGGCTCAGACATCATCCTTAACATGCACAAGGAAGGTGAATTGGAGCAGAAG
CTTAAAGACGTCTCCGGAAACCAAGATTGA