Details for Arabidopsis Locus AT3G15650

Position : Chr3 ( 5`- 5305918 .. 5307968 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15650

Protein [Map View]
MSYSRQSMGSGSRSTRGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSRILACSLITTSHFGSVSFCSSSQLLESLPLPNI
KWICPTAPSRPVSLLGGFPCTAWFDVGEISEDLHDDIEGLDASAAHIANLLSAEPTDVKVGIGGFSMGAAIALYSTTCYA
LGRYGTGHAYTINLRATVGLSGWLPGWRSLRSKIESSNEVARRAASIPILLAHGTSDDVVPYRFGEKSAHSLAMAGFRQT
MFKPYEGLGHYTVPKEMDEVVHWLVSRLGLEGSR*

DNA
ATGAGCTATTCTCGTCAAAGCATGGGTTCTGGTAGTAGAAGTACAAGGGGCTATGAGTTTGGAAGGACTTATGTTGTGAG
GCCTAAAGGAAAGCACCAAGCTACTATTGTTTGGTTGCACGGTCTTGGAGACAATGGCTCCAGAATTTTGGCGTGTTCTT
TGATAACAACTTCTCACTTTGGCTCTGTTTCTTTCTGCAGCTCGTCTCAGCTATTGGAAAGCCTACCTCTTCCAAACATC
AAATGGATTTGTCCAACTGCTCCTTCGCGTCCTGTTTCGCTTCTCGGTGGATTTCCTTGCACTGCCTGGTTTGACGTGGG
AGAAATTTCTGAGGATCTTCATGATGATATAGAAGGCTTAGATGCTTCAGCTGCACATATTGCTAACCTATTATCTGCTG
AGCCAACAGATGTCAAAGTTGGGATAGGAGGTTTCAGTATGGGTGCAGCAATAGCTCTCTACTCCACGACGTGCTACGCT
CTTGGACGTTATGGAACCGGACATGCTTATACTATAAACCTACGAGCTACTGTAGGACTTAGCGGTTGGCTTCCTGGTTG
GAGGAGCTTAAGGAGCAAAATAGAAAGTTCGAATGAGGTTGCAAGGCGCGCTGCATCGATACCGATCTTACTTGCACATG
GAACTTCGGACGATGTAGTTCCTTATAGATTTGGAGAAAAATCTGCTCATTCACTTGCCATGGCTGGATTCCGACAAACT
ATGTTCAAACCATATGAAGGGCTTGGTCACTATACGGTTCCTAAAGAAATGGATGAGGTGGTTCACTGGCTCGTCTCAAG
GCTTGGTCTCGAGGGTTCGCGTTAA