Details for Arabidopsis Locus AT3G15640

Position : Chr3 ( 5`- 5299110 .. 5301745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15640

Protein [Map View]
MWRRIVSSQLKTLAADVVAASPRRSIAATTRPVGFYLAANRSAISASSFVIPRRFSSDSVETPATKKVEDVMPIATGHEK
EELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGP
GGPPDGHGDEDDEHHH*

DNA
ATGTGGAGAAGAATCGTCTCCTCTCAGCTCAAAACCCTAGCCGCCGATGTCGTCGCTGCTTCTCCTCGTCGATCGATAGC
CGCCACCACCAGACCTGTCGGTTTCTATCTCGCCGCCAATCGATCAGCCATTTCCGCATCTTCTTTCGTTATCCCTCGTC
GTTTCAGCTCCGATTCAGTAGAGACTCCTGCGACGAAGAAGGTGGAGGATGTAATGCCCATTGCGACTGGACACGAGAAG
GAAGAGCTTGAAGCTGAACTTGAGGGAAGGAGGCTGGATGATATTGACTTCCCTGAAGGTCCTTTTGGAACTAAGGAAGC
TCCTGCTATTGTGAAGTCCTACTATGACAAGCGAATTGTGGGCTGCCCTGGTGGTGAAGGCGAGGACGAGCACGATGTTG
TCTGGTTCTGGCTGGAGAAAGGAAAGTCCTTTGAATGCCCGGTTTGCACTCAGTACTTTGAGCTGGAAGTGGTTGGTCCT
GGTGGTCCTCCGGATGGTCACGGTGACGAAGACGATGAGCACCACCACTGA