Details for Arabidopsis Locus AT3G15610

Position : Chr3 ( 5`- 5290847 .. 5293090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15610

Protein [Map View]
MEKKKVATPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSQPMLRNGETGDWIGTFEGHKGAVWSSCLDNNALRAASAS
ADFSAKLWDALTGDVLHSFEHKHIVRACAFSQDTKYLITGGFEKILRVFDLNRLDAPPTEIDKSPGSIRTLTWLHGDQTI
LSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSG
NKFVAGGEDMWVRLFDFHTGKEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEISESKPKQSVDEVA
RKIEGFHINKEGKTAEKPSDA*

DNA
ATGGAGAAGAAGAAAGTCGCGACTCCGCTAGTGTGCCATGGCCATTCGAGACCTGTTGTGGATTTGTTCTACAGTCCAAT
CACTCCTGATGGTTTCTTCCTCATCAGCGCAAGTAAAGATTCTCAACCAATGTTGAGAAATGGGGAAACTGGAGATTGGA
TTGGTACATTTGAAGGTCATAAAGGTGCTGTGTGGAGTTCTTGTCTTGATAACAATGCTTTACGTGCAGCTTCTGCATCT
GCTGATTTTTCAGCGAAGCTTTGGGATGCTTTGACTGGGGATGTCTTGCATTCTTTTGAGCACAAGCATATTGTTCGAGC
ATGCGCCTTCTCTCAGGATACGAAATATCTAATCACAGGAGGATTTGAGAAAATTCTTCGTGTTTTCGACTTGAATCGCT
TGGATGCACCTCCTACAGAAATTGATAAATCTCCTGGTTCTATCAGAACACTAACATGGCTTCACGGTGATCAAACAATA
TTAAGTTCTTGCACTGATATTGGTGGTGTGAGGTTATGGGATGTGAGGAGTGGCAAAATAGTGCAAACTCTAGAAACCAA
GTCTCCTGTCACCAGTGCTGAAGTGAGTCAAGATGGACGGTATATAACAACTGCCGATGGGTCAACTGTTAAATTTTGGG
ATGCAAATCATTTTGGACTAGTGAAAAGTTACGACATGCCCTGCAATATCGAATCTGCATCGCTTGAGCCAAAATCTGGC
AACAAATTCGTTGCTGGTGGAGAAGATATGTGGGTTCGACTCTTTGATTTCCACACCGGAAAGGAGATTGGATGCAACAA
GGGACATCATGGTCCGGTTCACTGTGTGAGATTTGCACCAACAGGTGAGTCTTATGCTTCAGGGTCTGAAGATGGTACAA
TCAGAATTTGGCAAACTGGACCGGTGAATCCTGAAGAGATCAGCGAGTCAAAGCCGAAGCAGAGTGTGGATGAGGTTGCT
CGTAAGATTGAAGGCTTTCACATTAACAAGGAAGGAAAAACCGCAGAGAAACCATCTGATGCTTAA