Details for Arabidopsis Locus AT3G15605

Position : Chr3 ( 5`- 5287323 .. 5290971 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15605

Protein [Map View]
MLQSNSAGGEDNPDFKWGAKRGVGRKDNKVRFYESFTLEGIEYRLFDCAYFYRFLGEYEPQWDELFLACGDEKGVSNIND
VETIMGKCNVVCTSDDRRNPRPGTKELRRAKYIFSRTFDTRLRIISEDFADAIAGIGVDKLFNMRRDKQPVKRLNSSAAA
ITRASPVKSFRPDLGSTKLGKHDNRDAKLMSRTSSLKKVTFLEDRADHVHVKRNPPVNTETTTRGQIPILKTRAFGELYA
SGSSVNAKPSKKRKLILNTPETDDSDDQGPQSGEKKLIKNPPLVEKAPSQNIEKKSWYKKLPFEDELKPAIEKGRVLLIE
NLEPSYTSLEVEFLFRQAFKEGVDAKMIPSSPMSSPHSGRALVIFGTTKAADSAMSRLNEDCLMLSGQRALTGSKNVPVE
IGRCRSFTGHFNMVDRSLMTAQKVSCCITLRLFSVVISLVMVTHRKPNSPCQITEYYKLTPLFSLIIVNRPHKFVNFQPH
P*

DNA
ATGTTGCAATCGAATAGTGCTGGTGGAGAAGACAACCCTGATTTTAAGTGGGGTGCTAAGAGAGGGGTGGGACGGAAAGA
TAATAAAGTCCGGTTCTATGAATCATTTACCCTTGAGGGCATCGAGTACCGGCTTTTTGACTGTGCTTACTTTTACCGCT
TCTTGGGAGAGTATGAGCCACAATGGGATGAGTTGTTTCTGGCTTGTGGTGATGAAAAAGGGGTTTCCAATATCAATGAT
GTGGAGACCATCATGGGGAAATGCAATGTTGTATGCACATCTGATGACCGAAGAAACCCACGACCAGGAACCAAGGAGCT
GCGGAGAGCTAAATATATCTTCTCCCGCACTTTTGATACAAGACTCAGAATTATATCAGAAGACTTTGCAGATGCTATAG
CCGGAATTGGAGTGGATAAACTCTTCAACATGAGAAGAGATAAACAGCCTGTAAAACGTCTAAACTCAAGCGCAGCTGCC
ATTACTAGGGCTTCTCCAGTTAAATCTTTTCGTCCAGATTTGGGATCAACAAAGTTAGGTAAACATGATAACAGAGATGC
AAAGCTGATGAGTAGAACAAGCTCGTTAAAGAAAGTCACTTTTCTGGAGGACCGTGCTGATCATGTACATGTGAAAAGGA
ACCCTCCTGTCAATACTGAAACCACTACAAGAGGTCAGATACCGATACTCAAAACAAGAGCATTTGGGGAGTTATATGCT
TCAGGTTCATCAGTGAATGCTAAGCCTTCTAAAAAGAGAAAGCTTATACTCAACACGCCAGAAACAGATGATTCAGATGA
TCAAGGCCCTCAATCAGGAGAGAAGAAATTAATTAAAAATCCTCCTCTTGTAGAAAAGGCTCCAAGTCAGAACATCGAGA
AAAAAAGCTGGTACAAGAAACTGCCTTTTGAGGACGAACTAAAGCCGGCTATAGAAAAAGGTAGGGTGCTCTTAATTGAG
AACCTGGAACCATCATACACATCGCTGGAGGTAGAGTTTCTTTTTAGGCAAGCATTCAAAGAAGGAGTTGATGCTAAGAT
GATCCCTTCAAGTCCCATGTCTAGCCCACATAGTGGCAGGGCTCTTGTGATTTTTGGAACCACAAAGGCAGCTGATTCTG
CTATGTCGCGGTTAAATGAAGATTGTCTGATGTTATCTGGCCAGAGAGCTCTAACGGGTAGCAAAAATGTCCCAGTCGAA
ATTGGAAGATGTAGAAGCTTTACTGGCCATTTTAACATGGTGGATAGATCTCTGATGACGGCTCAGAAGGTAAGTTGTTG
CATTACTCTGCGCTTATTTTCAGTTGTCATTTCACTTGTCATGGTCACACATCGAAAGCCCAACAGCCCATGCCAAATTA
CTGAATATTACAAATTGACCCCACTATTTAGTCTTATAATCGTAAACAGACCCCATAAATTCGTAAATTTTCAGCCACAT
CCATAA