Details for Arabidopsis Locus AT3G15550

Position : Chr3 ( 5`- 5267351 .. 5270118 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15550

Protein [Map View]
MMGDYGITEEDLVIEEAQGYPRAYTKICRDFDAFPYKNGPPFTFMPYILQQNESLRCREVDQMFPVIDPKARPTTKPKIF
LSLLWKQLNHLGNAGFDPAVIRIDPYGNVVYFHADSASPLAWSFDHWFPCSRGGLTVPSNLRIVQWQARKNKKDKLEFLV
PWWDLQVGISVNQFLSIFAASSSDFRRRAFSFLFKEGENEELNGIQMVESHHFPQHFVESKDKFGLASAAVVFSRRDPYD
PSLVLRSLDYNRQTPARKMRFGATKENETPDLMKNPYQAIVAARDSLRHREEAQNMRAEMKKLDDETNDLTRKNNEDRLT
IQELENELVKRRRRAEKCRRLAESQCSYRNTLEKMIRDAMHQSVVYKEQVRLNQAASSALMARLEAQKAICDGSEKELHK
KFKEREELENLVKPELEKARKRSRLLLNDEDDLLLDDRDRNLSLYLPGTSEETSSHKELRVHFEEEHKAAASEAEIKKHC
EIEEEEEEQKTPEVSEKSLVALEDDKPVEEKPDVEEGKRSNRSFRAFHVFKAPENEEDEESRRERGKGNVEKWLHILLEN
NSKSDPHDLQTEKSKKIDEMIEKLDHKFPFLEKVDEEEVDLKLQAKEANNNTSKVDEEEVDLQLQAKETNNNTSKVEIRT
ESSRRSRMSFDLKNTPEKSGRDKVVKRSESARTFTRIPSSPSLIFGMKKGIDCIRKKPVVSGNDDENEYLVKNNFIKSSL
QTIKRAVKF*

DNA
ATGATGGGCGATTATGGTATAACGGAGGAAGATCTGGTGATCGAGGAAGCTCAAGGCTATCCTAGAGCTTACACTAAGAT
CTGTCGCGATTTTGATGCTTTTCCTTACAAAAATGGTCCTCCTTTCACTTTCATGCCCTACATTCTTCAGCAGAACGAGA
GCTTGAGATGCAGAGAAGTAGATCAGATGTTTCCAGTGATTGATCCGAAAGCGAGACCAACAACAAAACCCAAGATCTTC
CTCAGTCTCTTGTGGAAACAGCTTAATCATCTAGGAAATGCAGGATTTGATCCAGCTGTTATTCGGATTGATCCATATGG
GAATGTTGTTTACTTCCACGCTGATTCAGCTTCTCCTCTTGCTTGGAGTTTTGATCATTGGTTCCCTTGCTCAAGAGGAG
GTTTAACAGTACCAAGCAACCTAAGGATAGTGCAATGGCAAGCACGCAAGAACAAGAAGGACAAGCTTGAGTTCTTAGTA
CCATGGTGGGATCTTCAAGTTGGTATTTCTGTGAATCAGTTCTTATCGATTTTCGCTGCTTCTAGTTCTGATTTCAGGAG
GAGGGCATTTTCATTCTTGTTCAAAGAAGGCGAAAACGAAGAACTTAACGGTATACAAATGGTTGAATCACACCATTTTC
CACAACATTTTGTTGAATCAAAAGACAAGTTTGGGCTTGCTTCAGCTGCAGTTGTTTTTTCAAGAAGAGATCCTTATGAC
CCTTCATTAGTCTTGAGATCCCTTGATTACAATCGTCAAACACCTGCAAGGAAGATGAGATTTGGTGCAACCAAAGAGAA
TGAGACTCCAGACTTAATGAAAAATCCGTATCAAGCCATTGTTGCTGCGAGGGACTCACTGAGACACCGGGAGGAAGCGC
AGAATATGAGAGCCGAGATGAAGAAGTTGGATGATGAAACGAATGATTTGACAAGAAAGAACAATGAAGATCGGCTTACT
ATTCAGGAGCTAGAGAATGAGCTGGTTAAGCGAAGAAGAAGGGCTGAAAAGTGCAGGAGATTGGCAGAATCTCAATGCTC
TTACAGGAATACACTCGAGAAGATGATCCGTGATGCTATGCACCAGAGTGTTGTGTATAAAGAACAAGTGAGGTTAAACC
AGGCTGCGAGTAGTGCGCTTATGGCAAGATTAGAGGCGCAAAAAGCGATTTGTGATGGTTCAGAGAAAGAACTTCACAAG
AAGTTTAAAGAAAGAGAGGAGCTGGAGAATCTAGTGAAGCCTGAGTTAGAGAAAGCAAGGAAAAGATCAAGACTTTTGCT
GAATGATGAAGATGACTTGTTGCTAGACGATAGAGACAGGAACTTATCTCTGTATCTTCCAGGAACAAGTGAAGAGACGT
CGTCACATAAGGAGTTAAGGGTACATTTTGAAGAAGAGCATAAAGCAGCAGCTTCTGAGGCTGAAATTAAGAAGCATTGT
GAAATAGAGGAGGAGGAAGAGGAACAGAAGACTCCAGAGGTATCTGAGAAGTCTCTTGTTGCGTTGGAAGATGATAAACC
GGTTGAAGAAAAGCCAGATGTAGAAGAGGGGAAGAGAAGCAACAGAAGCTTCAGAGCATTCCATGTTTTCAAGGCACCTG
AGAATGAGGAAGATGAGGAAAGCAGGAGAGAGCGAGGGAAAGGAAACGTTGAGAAATGGCTTCATATTTTACTGGAGAAC
AACAGCAAAAGCGATCCACACGATCTTCAAACAGAGAAAAGCAAGAAGATTGATGAAATGATAGAGAAACTGGACCACAA
GTTCCCTTTTCTTGAAAAGGTTGATGAAGAAGAAGTGGATTTGAAGTTGCAGGCTAAGGAGGCAAACAACAACACAAGCA
AGGTTGATGAAGAAGAGGTGGACTTGCAGTTGCAGGCTAAGGAGACAAACAACAACACAAGCAAGGTGGAAATAAGAACT
GAAAGTTCTCGTAGAAGCAGAATGAGTTTTGATTTAAAGAACACACCAGAGAAGAGTGGCAGAGACAAAGTGGTGAAGAG
ATCAGAGAGTGCTAGAACCTTCACAAGGATTCCATCATCTCCATCACTCATCTTTGGAATGAAAAAGGGAATAGACTGCA
TCAGGAAGAAGCCAGTGGTTTCAGGAAACGACGATGAGAATGAGTATCTTGTCAAGAACAACTTCATCAAGTCTTCTCTT
CAAACAATCAAACGAGCTGTCAAATTCTAG