Details for Arabidopsis Locus AT3G15534

Position : Chr3 ( 5`- 5258876 .. 5259082 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15534

Protein [Map View]
MVCFCFLVDQKRKVKGSKPAAGTCSRCGRGARVADMKTSTRFCLIPIYCRSWRAIVCSFCGSVLKSYR*

DNA
ATGGTGTGTTTCTGTTTCTTGGTTGACCAGAAGAGGAAGGTTAAAGGAAGCAAACCGGCGGCAGGAACGTGTTCCCGGTG
TGGTCGTGGTGCAAGAGTCGCCGATATGAAGACTTCGACGAGGTTTTGTCTTATACCTATTTATTGTAGATCTTGGAGAG
CCATCGTCTGCAGCTTTTGCGGCTCTGTTCTTAAATCCTATCGTTGA