Details for Arabidopsis Locus AT3G15500

Position : Chr3 ( 5`- 5234617 .. 5236088 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15500

Protein [Map View]
MGLQELDPLAQLSLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKY
PNGSRPNRVAGSGYWKATGTDKVISTEGRRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLDDWVLCRIY
KKQTSAQKQAYNNLMTSGREYSNNGSSTSSSSHQYDDVLESLHEIDNRSLGFAAGSSNALPHSHRPVLTNHKTGFQGLAR
EPSFDWANLIGQNSVPELGLSHNVPSIRYGDGGTQQQTEGIPRFNNNSDVSANQGFSVDPVNGFGYSGQQSSGFGFI*

DNA
ATGGGTCTCCAAGAGCTTGACCCGTTAGCCCAATTGAGCTTACCGCCGGGTTTTCGGTTTTATCCGACTGACGAAGAGCT
GATGGTTGAATATCTCTGTAGAAAAGCCGCCGGTCACGACTTCTCTCTCCAGCTCATAGCTGAAATCGATCTCTACAAGT
TTGATCCATGGGTTTTACCAAGTAAGGCGTTATTCGGTGAAAAAGAATGGTATTTTTTCAGCCCGAGGGATAGGAAGTAT
CCAAACGGGTCAAGACCTAATCGGGTTGCCGGGTCGGGTTATTGGAAAGCCACCGGTACGGATAAAGTTATCTCGACGGA
GGGAAGAAGAGTTGGTATCAAGAAAGCTTTGGTGTTTTACATTGGAAAAGCTCCAAAAGGAACCAAAACCAATTGGATTA
TGCATGAGTACCGTCTCATCGAACCCTCTCGTCGAAATGGAAGCACCAAGCTTGATGATTGGGTTTTATGTCGAATATAC
AAAAAGCAAACAAGCGCACAAAAACAAGCTTACAATAATCTAATGACGAGTGGTCGTGAATACAGCAACAATGGTTCGTC
GACATCTTCTTCGTCTCATCAATACGACGACGTTCTCGAGTCGTTGCATGAGATTGACAACAGAAGTTTGGGGTTTGCCG
CCGGTTCATCAAACGCGCTGCCTCATAGTCATAGACCGGTTTTAACCAATCATAAAACCGGGTTTCAGGGTTTAGCCAGG
GAGCCAAGTTTTGATTGGGCGAATTTGATTGGACAGAACTCGGTCCCGGAACTCGGACTGAGTCATAACGTTCCGAGTAT
TCGTTACGGTGACGGTGGAACGCAGCAACAAACTGAGGGGATTCCTCGGTTTAATAATAACTCGGACGTCTCGGCTAATC
AGGGTTTTAGTGTTGACCCGGTTAACGGATTTGGGTACTCGGGTCAACAATCTAGTGGGTTCGGGTTTATTTGA