Details for Arabidopsis Locus AT3G15480

Position : Chr3 ( 5`- 5226248 .. 5227789 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15480

Protein [Map View]
MASKLVVIIVFILDLIAVGLAIAAEQRRSVGKVETDRDKQYDYCVYGTDIATSYGAGAFVLLFVSQVLIMAASRCFCCGK
SLNPGGSRACAIILFLICWVFFLIAEMCLLAASIRNAYHTQYRKMWKVEDPPSCEVIRKGVFAAGAAFTLFTAIVSQFYY
VCYSRARDAYQNPSY*

DNA
ATGGCTTCGAAGCTTGTAGTGATAATTGTGTTTATCCTCGATCTCATCGCCGTTGGGTTAGCCATTGCCGCCGAGCAGAG
AAGAAGTGTCGGCAAGGTTGAAACAGACAGAGACAAGCAATATGATTACTGTGTGTATGGTACTGACATTGCTACAAGTT
ATGGAGCTGGTGCATTTGTTCTTCTCTTTGTAAGCCAAGTCCTTATTATGGCTGCTAGTCGTTGCTTCTGTTGTGGAAAG
TCTCTTAACCCTGGCGGTTCAAGAGCTTGTGCCATTATTCTCTTCCTCATTTGCTGGGTGTTTTTCTTGATCGCTGAGAT
GTGTTTGCTTGCGGCATCAATCAGAAATGCGTACCACACACAGTATAGAAAGATGTGGAAAGTTGAAGATCCACCAAGCT
GTGAAGTTATAAGGAAAGGAGTTTTTGCAGCTGGTGCTGCATTCACACTCTTCACCGCCATTGTCTCTCAGTTCTACTAC
GTTTGCTACTCTCGTGCTAGAGATGCGTACCAGAATCCCTCCTACTAA