Details for Arabidopsis Locus AT3G15470

Position : Chr3 ( 5`- 5216262 .. 5220218 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15470

Protein [Map View]
MSYQNEEEEEGGDTNDCFYESLDRLASSSSCSCSASNSDYDSESSPRISSAASHDSEELYGGGRRRRYPFPVPRFPMGAS
KFDVWTSEPASVSERRSKLLNEMGLSRDPVLSRLKPVSDSSSSKDTGAAGFEISRSISCNQLARRDHGECSESVGGCASC
IVRSKSDITTSQCGDRDRRYTSPGNPCSCSVSKLSVHHSSHSEISRTSSPFVNCSVGSVSADSLRLNGDSDCVLRESVVN
EEVEVCTIKNLDNGKEFVVNEIQEDGTWKKVKEVGTGTQMTMEEFEMCVGHSPIVQELMRRQNVEDSDKNTSKENEDSGN
SNKDNASKSKKKGSWFKSIKSVASSMTGHSKERRSSDDRDTSSERGGRRSSSATDDSQESSFHGPERVRVRQYGKSSKEL
TALYKTQEIQAHNGSIWSIKFSLDGKYLASAGEDCIIHIWQVVEAEKKGELLLDRPELLLLATNGSPEPTTMSPRRRGRT
SISRKSLSLENIFVPDSLFGLSEKPFCSFQGHVDDVLDLAWSKSQHLLSSSMDKTVRLWNLSSQTCLKVFSHSDYVTCIQ
FNPVDDRYFISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQGVLVGSYKGSCRMYSASDNKLQQKSQINLQNK
KKKAHQKKITGFQFVPGSSSEVLVTSSDSRIRVVDGTDLVNKLKGFRNTSSQISASITADGKYVVSASEDSHVYIWKYES
PASRPSRSNNNKNVTVTNSYEHFHSQDVSAAISWPGMASTENWGTQNRAGFNGSTNNLDNISTANHPPTPVDQLGTVERL
NSPRNGIISSATNGYFFDRMSATWPEEKLLFARNRSGNRLSTDMSSSNGNSGNVSASWGMVIVTAGLRGEIRTFQNFGLP
IRI*

DNA
ATGAGCTACCAAAACGAGGAAGAAGAGGAAGGAGGAGACACCAACGATTGCTTCTACGAGTCTCTTGATCGTTTAGCTTC
TTCCTCTTCTTGCTCTTGTTCCGCTTCTAACTCTGATTACGATTCCGAATCCTCTCCTCGGATCTCCTCCGCCGCTTCTC
ATGACTCTGAAGAACTCTACGGTGGTGGTCGCCGCCGTCGATACCCATTCCCTGTTCCTCGGTTTCCAATGGGAGCTTCG
AAGTTCGACGTTTGGACCTCTGAACCTGCTTCTGTCTCTGAGAGGCGTTCCAAGCTTTTAAACGAAATGGGTCTTAGCCG
TGACCCGGTTCTCTCCCGGTTAAAACCCGTTTCAGATTCTTCCAGCTCCAAAGATACCGGAGCCGCCGGCTTCGAGATTT
CTCGATCGATCTCGTGTAATCAATTGGCTCGGCGAGATCATGGAGAGTGTTCTGAAAGTGTCGGCGGTTGTGCTTCTTGT
ATCGTGAGATCGAAATCCGACATTACCACTAGCCAATGTGGTGATCGTGACCGTCGATATACGTCTCCTGGTAATCCTTG
TTCTTGTTCCGTCTCTAAACTCTCTGTTCATCATTCTTCACATTCAGAGATCAGTAGAACCAGCTCGCCATTTGTGAATT
GCAGTGTAGGATCAGTTAGTGCTGATTCATTGCGGTTAAATGGAGATTCTGATTGTGTACTGAGAGAGAGTGTAGTGAAT
GAGGAAGTGGAAGTGTGTACTATTAAGAATCTTGATAATGGGAAAGAGTTTGTGGTGAATGAGATTCAAGAAGATGGTAC
ATGGAAGAAGGTGAAGGAAGTGGGAACTGGAACACAGATGACGATGGAGGAGTTTGAGATGTGTGTTGGACATTCTCCCA
TTGTTCAGGAGCTTATGAGAAGACAGAACGTTGAGGATTCTGATAAGAACACGTCTAAGGAAAACGAAGACAGTGGGAAT
AGTAATAAGGATAATGCATCCAAGTCTAAGAAGAAAGGAAGTTGGTTTAAGAGTATTAAGAGTGTTGCAAGTAGCATGAC
TGGTCATAGCAAAGAGAGACGAAGCAGCGATGATAGAGATACATCGTCAGAGAGAGGTGGTCGGAGGTCGAGCTCTGCTA
CTGATGATTCTCAGGAATCTTCTTTTCATGGGCCGGAAAGAGTTAGGGTTAGACAGTATGGGAAATCATCTAAAGAGCTC
ACGGCATTGTACAAAACGCAGGAGATTCAAGCGCATAATGGTTCTATTTGGAGCATTAAGTTTAGTTTGGATGGTAAATA
TCTTGCTAGTGCTGGTGAGGATTGCATCATTCACATCTGGCAAGTCGTTGAGGCTGAGAAGAAGGGTGAGTTGTTACTTG
ATAGACCGGAACTGTTGCTTTTGGCTACTAATGGGTCTCCAGAACCGACTACTATGTCACCAAGGAGAAGAGGGAGAACT
TCTATAAGTAGAAAGTCATTGAGTTTAGAGAACATATTTGTTCCAGATTCTCTTTTCGGGCTTTCGGAAAAGCCCTTTTG
TTCCTTTCAGGGACATGTGGATGATGTACTTGACCTTGCTTGGTCCAAGTCTCAGCATTTGCTCTCTTCATCAATGGATA
AAACAGTTCGTTTGTGGAATTTGTCCAGCCAGACTTGCTTGAAAGTATTTTCGCACAGTGATTACGTGACTTGCATTCAA
TTTAATCCGGTTGATGATAGATACTTCATCAGTGGATCCTTAGATGCAAAAGTTCGCGTCTGGAGCATTCCAGATCGTCA
AGTAGTTGACTGGTATGATCTTCATGAGATGGTCACTTCTGCTTGCTACACTCCAGATGGTCAGGGTGTGTTGGTTGGTT
CATACAAAGGTAGCTGTCGGATGTACAGTGCATCAGATAACAAGCTGCAACAGAAAAGCCAGATAAATTTACAGAACAAG
AAGAAGAAAGCTCATCAAAAAAAGATAACTGGTTTCCAGTTTGTTCCTGGGAGCTCATCTGAAGTGCTTGTCACATCTTC
CGATTCAAGGATCCGTGTTGTTGATGGAACTGATCTAGTTAACAAACTTAAAGGGTTTCGAAATACGAGCAGCCAGATCT
CTGCCTCAATCACAGCAGATGGGAAATACGTAGTTTCAGCAAGCGAGGATTCACACGTGTACATATGGAAGTACGAATCC
CCTGCTTCTCGACCAAGCAGAAGTAACAACAACAAGAACGTGACAGTCACAAACTCTTACGAGCATTTCCATAGCCAAGA
CGTCTCTGCAGCCATCTCATGGCCTGGAATGGCCTCAACAGAAAACTGGGGAACCCAAAACAGAGCGGGGTTTAACGGAA
GCACCAATAACTTGGACAATATCTCCACAGCTAACCATCCGCCTACACCGGTAGACCAGCTGGGGACTGTGGAGCGATTA
AACAGTCCACGGAATGGGATCATATCGAGCGCAACAAACGGATACTTTTTCGATAGAATGTCAGCGACTTGGCCTGAAGA
GAAACTGTTGTTTGCAAGGAACAGAAGTGGGAATCGTCTGAGTACGGATATGTCGTCGTCAAATGGAAACTCAGGGAATG
TATCGGCTTCTTGGGGAATGGTGATTGTCACTGCAGGTCTCAGAGGAGAGATACGAACGTTTCAGAACTTTGGTTTGCCC
ATTCGGATTTGA