Details for Arabidopsis Locus AT3G15450

Position : Chr3 ( 5`- 5212984 .. 5214124 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15450

Protein [Map View]
MLAIFQKAFAHPPEELNSPASHFSGKTPKLPGETLSDFLSHHQNNAFSMNFGDSAVLAYARQETSLRQRLFCGLDGIYCM
FLGRLNNLCTLNRQYGLSGKNSNEAMFVIEAYRTLRDRGPYPADQVLRGLEGSFAFVVYDTQTSSVFSALSSDGGESLYW
GISGDGSVVMSDDIQIIKQGCAKSFAPFPNGCMFHSETGLKSFDHPTNMMKAMPRIDSEGVLCGASFKVDACSKINSIPR
RGSEANWALANSR*

DNA
ATGTTGGCAATATTTCAGAAAGCTTTTGCTCACCCACCGGAAGAACTCAACAGTCCGGCTTCTCATTTCTCCGGCAAAAC
TCCTAAACTTCCCGGCGAAACTCTCTCCGACTTCCTCTCTCATCACCAAAACAATGCTTTCTCTATGAACTTCGGCGACT
CCGCCGTCTTAGCTTACGCTCGCCAAGAAACCTCTCTTCGTCAAAGGTTGTTCTGTGGACTAGATGGGATCTACTGTATG
TTTCTAGGGAGATTGAATAATCTCTGTACATTGAATCGACAATACGGTTTATCTGGGAAGAACTCAAACGAGGCAATGTT
TGTGATCGAAGCTTATCGAACACTTCGTGATCGTGGTCCTTACCCAGCAGATCAAGTTCTTAGAGGTCTTGAGGGAAGCT
TCGCTTTCGTTGTCTACGATACTCAAACTTCCTCTGTTTTCTCAGCTCTGAGTTCTGATGGAGGAGAGAGTCTTTACTGG
GGAATTTCTGGAGACGGATCTGTTGTAATGTCTGATGATATTCAGATCATAAAGCAAGGCTGTGCTAAATCGTTTGCTCC
TTTCCCTAATGGATGTATGTTTCATAGTGAGACAGGGCTTAAGAGCTTTGACCATCCGACTAATATGATGAAGGCAATGC
CGAGGATTGATAGTGAAGGTGTTCTTTGTGGAGCTAGTTTCAAAGTTGATGCTTGTTCTAAGATCAATAGTATCCCTAGA
AGAGGAAGTGAAGCTAACTGGGCGCTGGCTAATTCTCGTTGA