Details for Arabidopsis Locus AT3G15430

Position : Chr3 ( 5`- 5208738 .. 5211745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15430

Protein [Map View]
MADRNCLISFEDLPSHLILEVLTSGRLSAVDLLSLELTSKVFGGSHGFYPLKFRSLADYAASQLCSMHPVYVGMGLTTQK
ELFANCEGNWKRLFSFLQSVEQSSDMVETSQGKMQIATGKYHTLLINNSKVYSCGVSLSGVLAHGSETTQCVAFTPIEFP
FPAQVAQVSATQNHSAFVLQSGQVLTCGDNSSHCCGHLDTSRPIFRPKLVEALKGTPCKQVAAGLHFTVFLSREGHAYTC
GSNTHGQLGHGDTLDRPVPKVVEFLKTIGPVVQIAAGPSYVLAVTQDGSVYSFGSGSNFCLGHGEQQDELQPRVIQAFKR
KGIHILRVSAGDEHAVALDSNGRVYTWGKGYCGALGHGDENDKITPQVLVNLNNCLAVQVCARKRKTFVLVEGGLLYGFG
WMGFGSLGFPDRGVSDKVLRPRVLECLKPHRVSQVSTGLYHTIVVTQRGRIFGFGDNERAQLGHDSLRGCLEPTEIFLHC
GRSRSRLC*

DNA
ATGGCTGATCGAAACTGTTTGATTTCGTTCGAGGATCTTCCTTCTCATTTGATCTTGGAGGTGTTGACCTCTGGGAGGCT
TAGTGCGGTTGATCTACTTAGCTTGGAATTGACTTCTAAGGTTTTCGGAGGGAGCCATGGATTCTATCCTTTGAAATTCA
GATCATTAGCTGATTATGCGGCGTCTCAGCTTTGCTCTATGCACCCTGTCTACGTGGGAATGGGTTTGACTACACAGAAA
GAGCTCTTTGCCAATTGTGAGGGAAACTGGAAGCGGCTTTTTAGTTTCTTGCAGTCAGTTGAGCAATCCTCAGATATGGT
TGAAACCTCTCAAGGCAAAATGCAAATTGCAACAGGAAAGTATCACACTTTGCTAATCAACAACTCAAAGGTTTATTCTT
GTGGTGTAAGTTTGTCCGGTGTTCTTGCTCATGGCTCTGAAACTACTCAGTGTGTAGCATTTACACCTATAGAGTTTCCG
TTCCCTGCTCAAGTGGCTCAAGTCTCAGCCACACAGAACCATTCTGCTTTCGTATTGCAATCTGGACAGGTTCTCACTTG
TGGGGATAATTCATCGCATTGCTGTGGTCATTTAGATACTAGCCGTCCAATATTTAGGCCTAAGCTTGTTGAGGCTTTGA
AGGGGACTCCTTGTAAGCAGGTGGCTGCTGGGCTTCACTTTACTGTGTTTCTATCAAGGGAAGGGCATGCATATACTTGT
GGATCAAATACACATGGGCAGCTTGGTCATGGAGATACCTTGGACAGACCAGTACCCAAAGTTGTTGAGTTTCTTAAAAC
CATTGGCCCTGTGGTGCAAATTGCAGCTGGACCCAGCTATGTTTTAGCTGTAACACAGGATGGCTCGGTTTACTCGTTTG
GCTCTGGTTCTAACTTCTGTCTTGGTCATGGAGAGCAACAGGACGAGCTCCAGCCGCGTGTTATTCAGGCTTTTAAAAGA
AAAGGTATTCACATACTCCGTGTCTCTGCAGGCGATGAGCACGCCGTGGCACTTGATTCCAATGGCCGTGTCTACACATG
GGGTAAAGGTTACTGTGGTGCTCTAGGCCATGGAGACGAAAACGACAAGATCACTCCTCAAGTTTTGGTCAATCTCAACA
ATTGCCTTGCTGTCCAGGTGTGTGCAAGAAAAAGGAAGACTTTTGTTTTGGTGGAAGGTGGATTACTATATGGATTTGGG
TGGATGGGGTTTGGAAGCCTTGGGTTCCCGGACAGAGGAGTTTCAGACAAAGTTCTTAGGCCAAGAGTATTGGAGTGTCT
GAAACCACACCGTGTCTCTCAAGTTAGCACCGGTTTGTATCACACCATTGTGGTCACTCAACGTGGTCGCATTTTTGGGT
TTGGAGATAACGAAAGAGCTCAGCTTGGTCACGACTCACTCCGTGGCTGCTTAGAACCTACCGAAATCTTTCTCCATTGT
GGCCGTTCTCGTAGCCGGCTTTGTTGA