Details for Arabidopsis Locus AT3G15400

Position : Chr3 ( 5`- 5201644 .. 5203197 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15400

Protein [Map View]
MAQGHQGLCFGFIFLLCFFSSTFALRILKDLPMMEPRKLDLNHEMMPGMVMLQPDHEVQPEHTVKPGHTLQSMSGVSEHP
EHTVKPGHTLQSMSGALEHPEHKEKPDHKLQSMLGEHPEHKEKPDHKLQSMLGEHPEHKEKPDHKLQSMLGEHPEHKEKP
DHKLQSMSGESKHPEHKVKPDQIMQTMASELEEEDPDHTSKPMGYGVGRGYGSGGSGVGYGVGIGSSGGSGFGEGIGSSG
GNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIGSGSAQPNCGPVTGAPGSGFGEGIGQGSGPGEGI
GIGIGQGGPSVVVPGTRIPPIVVPGAQIPGFVIPGITVPGYGTGCQTGGCNPNPPHYYIPPSCPHCPPFTSGQDKHMSDK
GAMTEALAPTSPEIHV*

DNA
ATGGCTCAGGGACACCAAGGCTTATGCTTTGGGTTTATCTTCTTACTATGCTTCTTCAGCTCTACTTTTGCACTCAGGAT
TCTTAAGGACCTCCCTATGATGGAGCCAAGAAAGCTAGATCTGAACCATGAAATGATGCCTGGGATGGTTATGCTACAGC
CAGATCATGAGGTCCAACCTGAGCACACGGTCAAGCCTGGCCATACACTCCAGTCCATGTCCGGTGTATCAGAACATCCA
GAGCACACGGTTAAGCCTGGCCATACACTCCAGTCCATGTCCGGTGCATTAGAACATCCTGAGCACAAGGAAAAGCCTGA
CCATAAACTCCAGTCTATGTTGGGAGAACATCCTGAGCACAAGGAAAAGCCTGACCATAAACTCCAGTCTATGTTGGGAG
AACATCCTGAGCACAAGGAAAAGCCTGACCATAAACTCCAGTCTATGTTGGGAGAACATCCTGAGCACAAGGAAAAGCCT
GACCATAAACTCCAGTCCATGTCTGGTGAATCAAAACATCCTGAGCACAAAGTCAAGCCTGATCAGATAATGCAGACCAT
GGCGAGTGAACTGGAAGAGGAAGATCCTGACCACACAAGTAAGCCTATGGGGTATGGTGTAGGTAGGGGCTATGGAAGTG
GTGGGTCTGGTGTTGGCTATGGCGTTGGAATTGGCTCTAGTGGAGGCAGTGGCTTTGGAGAAGGTATTGGCTCTAGTGGA
GGCAACGGCTTTGGAGAAGGAATTGGCTCTAGTGGAGGCAGCGGCTTTGGAGAAGGAATTGGCTCTAGTGGAGGCAGCGG
CTTTGGTGAAGGAATTGGTTCTGGTGGTGGTACAGGTATTGGCATTGGAGAAGGAATAGGATCCGGGTCTGCCCAACCCA
ATTGCGGCCCTGTCACGGGAGCTCCAGGTAGCGGATTCGGTGAAGGCATAGGACAAGGTAGTGGTCCAGGGGAAGGGATT
GGTATCGGTATAGGACAGGGTGGACCTAGTGTAGTAGTCCCAGGCACAAGAATCCCTCCGATAGTGGTTCCAGGCGCACA
GATTCCCGGTTTTGTGATTCCAGGTATCACAGTTCCTGGCTACGGTACTGGATGCCAAACAGGTGGCTGCAATCCGAACC
CACCACACTACTATATCCCACCAAGCTGTCCCCATTGTCCACCTTTCACATCAGGACAAGACAAACACATGTCAGACAAA
GGAGCCATGACCGAAGCTCTTGCACCCACTTCACCGGAGATACATGTTTAA