Details for Arabidopsis Locus AT3G15395

Position : Chr3 ( 5`- 5200639 .. 5201514 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15395

Protein [Map View]
MGSRGIINDKWSMRILWGCAIGSAIGLYMVAVERQTQNRARAMAESLRAAESQGDGDNV*

DNA
ATGGGATCGAGAGGGATTATCAACGATAAGTGGTCAATGAGGATTCTATGGGGTTGTGCTATCGGAAGTGCTATTGGTTT
ATACATGGTTGCTGTAGAGAGACAAACTCAGAACAGGGCTCGTGCTATGGCTGAGAGTTTGAGAGCTGCTGAATCACAAG
GTGATGGTGATAATGTCTAA