Details for Arabidopsis Locus AT3G15390

Position : Chr3 ( 5`- 5196522 .. 5200337 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15390

Protein [Map View]
MSKIASSSNSDPDSRSLQVLLDTFGSRFSLDDIAAAYCQASQNVDVAGEILSAMAEKTPQCDQVEMKTATSKPTQVYVPK
EVPRQEDSKAKVWRPKRNSISNGTVSSVIGKEYARTRPISNAPKEATKPLKINSRDIPETEIWSEEMRKSNEGKISRAPT
DVEEFIVKMLGEGFQASQEVIHQVLGVCGYDVKKSTEKLLDFSDTKKYADVGISNEVMSKVDPQRQSTSCNQMELQKISQ
SVGARTFTGSQEGRNAKNGLEKEVLEALFSGAERYVDKPKVTRHFGERRPGVAGRPVFKPLEDPFQERVVAVKQSSNTSK
EDDDENEFKAHRKAVREHLNQMKEYYGAAAEAFSKGETERAHRLVEKGHFFGQKAREADDKSVAKMIDVNQEDDSTYEED
EVVTVNMNEHEAKEALRLLKRQLIYFSGISSFKYLRVQLGEKKEDFKSKRKHIVKLLEGESIPWTEEDGGLVIMIRVDEI
DPKKLSFAKK*

DNA
ATGTCAAAGATTGCAAGCTCTTCGAATAGTGATCCTGATTCAAGAAGCTTACAAGTGCTTCTCGATACTTTTGGTTCTCG
TTTTTCTCTTGATGACATTGCCGCTGCTTACTGCCAAGCTAGCCAGAATGTCGATGTAGCTGGTGAGATTCTCTCTGCAA
TGGCTGAAAAGACGCCTCAATGTGACCAAGTTGAAATGAAGACAGCAACCTCAAAACCAACTCAGGTCTATGTTCCTAAG
GAAGTTCCACGACAAGAGGATAGCAAAGCGAAAGTATGGAGGCCGAAGAGAAATTCTATATCAAATGGTACTGTTTCAAG
TGTTATTGGTAAGGAGTATGCTAGAACCAGGCCTATATCAAATGCTCCCAAAGAAGCAACTAAACCATTGAAGATAAACT
CAAGGGATATTCCAGAAACTGAGATATGGAGTGAAGAAATGCGAAAAAGTAACGAGGGAAAGATAAGCAGGGCTCCAACT
GATGTTGAGGAATTTATTGTTAAGATGCTTGGAGAAGGTTTTCAAGCTAGCCAAGAAGTCATTCACCAGGTTCTTGGCGT
ATGCGGATATGATGTGAAGAAGAGTACGGAGAAACTGCTTGACTTTTCTGATACCAAGAAATATGCTGATGTTGGAATTT
CCAATGAAGTTATGTCAAAAGTTGATCCTCAAAGACAATCTACATCCTGCAACCAAATGGAACTACAAAAAATTTCTCAG
AGTGTTGGAGCAAGAACCTTTACAGGTTCACAGGAAGGGCGTAATGCTAAGAATGGTCTTGAAAAGGAAGTTTTAGAAGC
TTTGTTCTCAGGTGCGGAAAGATATGTGGACAAACCAAAAGTAACTCGACATTTTGGAGAAAGGAGACCTGGAGTTGCTG
GTCGTCCTGTTTTTAAACCTCTGGAAGACCCTTTTCAAGAGAGAGTAGTTGCTGTGAAACAATCGTCCAATACATCTAAA
GAAGATGACGATGAAAATGAATTTAAGGCACATCGTAAAGCAGTACGCGAGCATTTGAATCAGATGAAAGAATATTATGG
AGCTGCTGCAGAAGCATTCTCCAAAGGAGAAACCGAGCGAGCACACAGACTCGTGGAGAAGGGACACTTTTTTGGACAAA
AAGCTCGAGAAGCAGATGACAAATCTGTAGCAAAGATGATTGACGTCAATCAAGAAGATGATTCAACTTACGAGGAAGAC
GAGGTAGTGACAGTAAATATGAATGAACACGAAGCAAAAGAAGCTCTTCGTCTTCTCAAGCGCCAACTTATTTACTTCTC
TGGCATTTCATCTTTCAAGTACCTCAGAGTCCAATTGGGTGAGAAGAAGGAAGATTTCAAGAGCAAACGAAAGCATATCG
TAAAGCTGCTGGAGGGAGAATCCATTCCTTGGACTGAAGAAGATGGCGGCCTCGTGATAATGATTCGGGTTGATGAGATT
GACCCCAAGAAATTGAGTTTTGCCAAGAAATAA