Details for Arabidopsis Locus AT3G15370

Position : Chr3 ( 5`- 5190572 .. 5192077 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15370

Protein [Map View]
MDMKGTYLVTVILLVSTLSVGMCSNGWIRAHATYYGVNDSPASLGGACGYDNPYHAGFGAHTAALSGELFRSGESCGGCY
QVRCDFPADPKWCLRGAAVTVTATNFCPTNNNNGWCNLPRHHFDMSSPAFFRIARRGNEGIVPVFYRRVGCKRRGGVRFT
MRGQGNFNMVMISNVGGGGSVRSVAVRGSKGKTWLQMTRNWGANWQSSGDLRGQRLSFKVTLTDSKTQTFLNVVPSSWWF
GQTFSSRGRQFV*

DNA
ATGGATATGAAGGGAACATACTTAGTAACGGTTATTCTCTTGGTTAGTACGTTAAGTGTGGGGATGTGTTCTAACGGTTG
GATAAGAGCTCATGCAACGTATTATGGTGTCAATGATAGCCCTGCTTCACTTGGAGGAGCTTGTGGGTATGACAATCCGT
ACCACGCCGGATTCGGAGCACACACGGCGGCGCTAAGCGGTGAGCTATTCAGAAGCGGTGAGTCATGCGGTGGGTGCTAC
CAGGTGAGGTGCGACTTTCCGGCGGATCCTAAGTGGTGTCTCCGAGGAGCCGCCGTGACGGTGACGGCTACAAACTTTTG
CCCAACGAATAACAATAATGGTTGGTGCAATCTCCCTCGCCATCACTTTGACATGTCCTCCCCCGCTTTCTTCCGCATTG
CCCGTCGCGGCAATGAAGGCATCGTCCCCGTCTTCTATCGCCGGGTGGGATGCAAAAGAAGAGGAGGCGTGAGGTTCACG
ATGAGAGGGCAAGGTAACTTCAATATGGTAATGATCTCAAACGTTGGTGGTGGCGGCTCGGTGAGATCAGTAGCGGTGAG
AGGCTCAAAGGGAAAGACTTGGCTTCAGATGACCCGTAATTGGGGTGCCAACTGGCAGAGCTCCGGTGATCTCCGGGGAC
AGAGACTCTCCTTCAAAGTTACTCTGACGGACAGCAAAACGCAGACATTTTTGAACGTTGTCCCTTCTTCTTGGTGGTTT
GGCCAAACCTTCTCTTCTCGAGGAAGACAATTCGTTTAA