Details for Arabidopsis Locus AT3G15360

Position : Chr3 ( 5`- 5188374 .. 5189697 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15360

Protein [Map View]
MASLLDSVTVTRVFSLPIAASVSSSSAAPSVSRRRISPARFLEFRGLKSSRSLVTQSASLGANRRTRIARGGRIACEAQD
TTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVP
TVIIFKGGEKKDSIIGAVPRETLEKTIERFLVE*

DNA
ATGGCGTCGTTACTCGATTCCGTCACCGTGACCCGCGTGTTTTCTCTGCCGATTGCGGCTTCGGTCTCGTCTTCTTCAGC
TGCTCCGTCGGTTTCACGACGCCGGATTTCTCCCGCCAGGTTTCTGGAATTCAGAGGTTTGAAGTCTTCGCGGAGTTTGG
TGACTCAGTCGGCCAGTCTGGGTGCGAATCGTAGAACCAGAATCGCTCGCGGTGGACGAATCGCCTGTGAGGCTCAGGAC
ACCACTGCCGCCGCCGTCGAAGTACCAAATCTGTCTGATTCAGAATGGCAAACAAAGGTTCTGGAATCAGATGTCCCAGT
TCTGGTCGAGTTCTGGGCACCATGGTGTGGACCTTGCCGTATGATTCACCCCATAGTTGACCAGCTAGCCAAAGATTTCG
CAGGGAAGTTCAAATTCTACAAAATCAACACTGACGAGAGCCCAAATACAGCAAACCGTTACGGGATACGAAGCGTTCCA
ACAGTAATCATCTTCAAAGGCGGTGAGAAGAAAGATAGCATCATTGGAGCTGTGCCTAGAGAGACGTTGGAGAAAACTAT
AGAAAGATTCTTGGTCGAGTAA