Details for Arabidopsis Locus AT3G15357

Position : Chr3 ( 5`- 5187116 .. 5187710 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15357

Protein [Map View]
MASASSSAARSLIRDGKSLTNLFLRGRKINLTETVQNNGPAIRSLLCFNQMPAASQYPVYSETFPVMKSGLRVGFVQKEA
VSERVGKMEAAHGKRVVDNKDADSEEDTDFDEDEIDDVDFEDDEDSDEDDEEEEDDKYTRKKK*

DNA
ATGGCTTCAGCTTCATCATCGGCGGCGAGATCACTCATCCGCGACGGAAAATCGTTGACGAATCTATTCCTCCGTGGACG
TAAGATCAATCTCACCGAGACAGTACAGAACAATGGACCGGCCATTCGATCTCTGCTTTGTTTTAACCAGATGCCGGCGG
CTAGCCAATACCCTGTTTACTCTGAAACTTTTCCGGTTATGAAATCCGGTTTACGTGTCGGCTTCGTTCAGAAGGAGGCC
GTTTCGGAGAGAGTAGGGAAAATGGAGGCGGCTCATGGAAAGCGAGTGGTGGACAACAAAGATGCTGATTCAGAGGAGGA
CACGGATTTTGATGAAGACGAGATTGATGACGTTGACTTTGAAGACGATGAAGATTCTGACGAAGATGATGAGGAAGAGG
AGGATGACAAGTACACAAGGAAGAAGAAGTAA