Details for Arabidopsis Locus AT3G15353

Position : Chr3 ( 5`- 5180642 .. 5181586 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15353

Protein [Map View]
MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEENNANCKCKCGSSCSCVNCTCCPN*

DNA
ATGTCAAGCAACTGCGGAAGCTGCGACTGTGCTGACAAGACCCAGTGCGTAAAGAAGGGAACCAGCTACACCTTCGACAT
CGTCGAGACTCAGGAGAGCTACAAGGAGGCCATGATCATGGACGTTGGTGCCGAGGAGAACAACGCAAATTGCAAGTGCA
AGTGCGGCTCCTCTTGCAGCTGCGTCAACTGCACTTGCTGCCCCAACTAA