Details for Arabidopsis Locus AT3G15352

Position : Chr3 ( 5`- 5179413 .. 5180665 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15352

Protein [Map View]
MTDQPAQNGLIPPPTSEPSKAAASAETKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHKICLRAEGFNV*

DNA
ATGACTGATCAGCCAGCACAAAATGGATTGATTCCTCCACCCACTTCAGAGCCAAGCAAGGCTGCTGCCTCAGCAGAGAC
GAAACCAAAGAAGAGGATATGTTGTGCTTGCCCTGATACCAAGAAGCTGAGAGATGAGTGCATTGTCGAGCATGGTGAAT
CGGCTTGCACTAAATGGATCGAGGCTCATAAAATTTGTCTCCGAGCAGAAGGTTTCAACGTCTGA