Details for Arabidopsis Locus AT3G15351

Position : Chr3 ( 5`- 5176059 .. 5177648 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15351

Protein [Map View]
MDLDPKKFAALLDKIEAEADEFLLARNQMVENDKERNANREALTALRKRARTTKTSVMSPFDSMMKDIHGSSTKPLVQEV
CSTCGSHDSSEPTWMMLPGADLFAAIPFHAVHTMLEKDEEKMEFESKKLQSLVKEKALFISELGALADGISPGVIRSLVA
LEDKP*

DNA
ATGGATTTGGATCCAAAGAAGTTTGCTGCACTATTGGACAAAATTGAAGCTGAAGCTGATGAGTTTCTATTAGCTCGAAA
TCAGATGGTGGAGAATGACAAGGAGAGGAATGCAAACCGAGAGGCTCTTACAGCACTAAGGAAGAGAGCTCGGACAACAA
AGACTAGTGTTATGTCTCCATTTGATTCTATGATGAAGGATATCCATGGGAGCTCAACGAAACCTTTGGTCCAAGAAGTT
TGCTCCACATGTGGATCCCATGACTCTAGTGAACCCACCTGGATGATGCTCCCAGGAGCTGATCTTTTTGCTGCAATTCC
GTTTCATGCTGTGCATACAATGCTAGAGAAAGATGAAGAGAAAATGGAGTTTGAATCGAAGAAGTTACAGAGCTTAGTGA
AGGAAAAAGCTCTGTTTATATCGGAACTAGGGGCTCTTGCTGATGGTATTTCTCCTGGCGTTATCAGATCGTTGGTGGCT
TTAGAGGACAAACCTTAA