Details for Arabidopsis Locus AT3G15290

Position : Chr3 ( 5`- 5144997 .. 5146856 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15290

Protein [Map View]
MAEMKSVGVVGAGQMGSGIAQLAATSGLDVWLMDADRDALSRATAAISSSVKRFVSKGLISKEVGDDAMHRLRLTSNLED
LCSADIIVEAIVESEDIKKKLFKDLDGIAKSSAILASNTSSISITRLASATRRPSQVIGMHFMNPPPIMKLVEIIRGADT
SEETFLATKVLAERFGKTTVCSQDYAGFVVNRILMPMINEAFHTLYTGVATKEDIDSGMKHGTNHPMGPLELADLIGLDV
CLSVMKVLHEGLGDSKYAPCPLLVQYVDAGRLGRKRGVGVYDYREATQKLSPRL*

DNA
ATGGCGGAGATGAAGAGTGTCGGAGTAGTTGGTGCTGGACAAATGGGTTCAGGAATCGCGCAACTCGCCGCCACGAGTGG
CCTCGACGTTTGGCTCATGGACGCTGATCGAGATGCCCTCTCTCGAGCCACCGCAGCTATCTCCTCCTCCGTCAAACGAT
TCGTCTCCAAAGGTCTAATCTCCAAGGAAGTTGGTGATGATGCTATGCATCGTCTACGATTAACATCGAATCTTGAAGAT
TTGTGTTCTGCTGATATCATCGTTGAAGCCATTGTGGAATCAGAAGACATTAAGAAGAAGCTGTTTAAGGATCTAGATGG
TATAGCTAAGAGTTCTGCGATTTTAGCTTCTAACACAAGTTCTATATCCATTACTCGTCTTGCATCTGCTACGAGAAGAC
CCAGCCAGGTCATTGGAATGCACTTTATGAACCCTCCTCCAATAATGAAACTGGTTGAAATCATTCGCGGTGCAGATACC
TCAGAAGAGACGTTTCTTGCTACAAAAGTTCTGGCTGAAAGGTTTGGCAAGACAACAGTCTGCTCACAAGACTATGCGGG
ATTCGTAGTGAACCGAATCCTCATGCCTATGATCAATGAAGCGTTCCACACACTTTACACAGGGGTAGCTACAAAGGAAG
ACATTGACAGCGGAATGAAACACGGCACAAACCACCCGATGGGTCCTTTGGAGTTGGCGGACTTAATCGGTCTAGACGTG
TGCTTGTCCGTAATGAAAGTGTTGCACGAGGGACTTGGGGACTCAAAGTACGCACCTTGCCCTCTTCTTGTTCAATACGT
TGATGCTGGGAGATTAGGAAGAAAACGAGGAGTAGGAGTTTATGATTACCGTGAAGCTACACAGAAGCTGTCTCCGCGGC
TCTGA