Details for Arabidopsis Locus AT3G15270

Position : Chr3 ( 5`- 5140365 .. 5141348 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15270

Protein [Map View]
MEGQRTQRRGYLKDKATVSNLVEEEMENGMDGEEEDGGDEDKRKKVMERVRGPSTDRVPSRLCQVDRCTVNLTEAKQYYR
RHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKISGDSFGEGSGRRGFSGQLIQTQE
RNRVDRKLPMTNSSFKRPQIR*

DNA
ATGGAGGGTCAGAGAACACAACGCCGGGGTTACTTGAAAGACAAGGCTACAGTCTCCAACCTTGTTGAAGAAGAAATGGA
GAATGGCATGGATGGAGAAGAGGAGGATGGAGGAGACGAAGACAAAAGGAAGAAGGTGATGGAAAGAGTTAGAGGTCCTA
GCACTGACCGTGTTCCATCGCGACTGTGCCAGGTCGATAGGTGCACTGTTAATTTGACTGAGGCCAAGCAGTATTACCGC
AGACACAGAGTATGTGAAGTACATGCAAAGGCATCTGCTGCGACTGTTGCAGGGGTCAGGCAACGCTTTTGTCAACAATG
CAGCAGGTTTCATGAGCTACCAGAGTTTGATGAAGCTAAAAGAAGCTGCAGGAGGCGCTTAGCTGGACACAATGAGAGGA
GGAGGAAGATCTCTGGTGACAGTTTTGGAGAAGGGTCAGGCCGGAGAGGGTTTAGCGGTCAACTGATCCAGACTCAAGAA
AGAAACAGGGTAGACAGGAAACTTCCTATGACCAACTCATCATTCAAGCGACCACAGATCAGATAA