Details for Arabidopsis Locus AT3G15260

Position : Chr3 ( 5`- 5138686 .. 5142644 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15260

Protein [Map View]
MTGREILHKMKESVKEKVGLGASASSADSGKGKSKMLKQITHGFHLVKGKAFHEMEDYVVAKFKEVDDNELGLFAIFDGH
LSHEIPDYLCSHLFENILKEPNFWQEPEKAIKKAYYITDTTILDKADDLGKGGSTAVTAILINCQKLVVANVGDSRAVIC
QNGVAKPLSVDHEPNMEKDEIENRGGFVSNFPGDVPRVDGQLAVARAFGDKSLKMHLSSEPYVTVEIIDDDAEFLILASD
GLWKVMSNQEAVDSIKGIKDAKAAAKHLAEEAVARKSSDDISVVVVKFQ*

DNA
ATGACCGGTAGAGAAATCCTCCACAAGATGAAGGAATCCGTCAAGGAGAAAGTTGGGCTTGGTGCATCTGCTTCATCTGC
AGATTCAGGGAAAGGTAAGAGCAAGATGTTGAAGCAGATCACACATGGTTTTCATTTGGTGAAAGGGAAAGCTTTTCACG
AGATGGAAGATTATGTGGTTGCCAAATTCAAGGAAGTTGATGATAATGAGCTTGGTCTGTTTGCTATCTTCGATGGCCAT
CTTAGCCACGAGATTCCGGACTACTTGTGCTCCCATTTGTTTGAGAACATCTTGAAAGAGCCGAATTTCTGGCAAGAACC
TGAGAAAGCGATAAAGAAAGCTTACTATATAACGGATACAACGATTCTAGACAAGGCAGATGATTTGGGAAAAGGAGGTT
CTACTGCTGTGACTGCGATATTGATCAATTGCCAGAAGCTGGTGGTTGCTAATGTTGGTGACTCTCGAGCTGTTATTTGC
CAAAATGGTGTTGCGAAGCCACTCTCAGTTGATCATGAGCCGAACATGGAGAAGGATGAAATCGAGAACAGAGGAGGATT
CGTTTCTAACTTTCCTGGGGATGTTCCTCGAGTTGATGGTCAACTGGCTGTGGCAAGGGCATTTGGTGATAAGAGTTTAA
AGATGCATTTGAGTTCAGAACCATATGTTACGGTGGAGATAATTGATGATGATGCAGAATTTCTTATCCTAGCAAGTGAT
GGACTATGGAAGGTCATGTCAAACCAAGAAGCCGTTGACTCAATCAAGGGAATAAAAGATGCGAAGGCTGCAGCAAAGCA
CCTTGCAGAGGAGGCTGTTGCAAGGAAAAGCTCAGACGATATCTCAGTCGTCGTCGTGAAATTTCAGTGA