Details for Arabidopsis Locus AT3G15240

Position : Chr3 ( 5`- 5133606 .. 5135902 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15240

Protein [Map View]
MVGSEHHHHHQQHHHQNHQQQQQRSKEALGMVALHDALRTVCLNTDWTYSVFWSIRPRPRVRGGGNGCKVGDDNGSLMLM
WEDGYCRGRGGTEGCYGDMEGEDPVRKSFSKMSIQLYNYGEGLMGKVASDKCHKWVFKEQTESESNASSYWQSSFDAIPS
EWNDQFESGIRTIAVIQAGHGLLQLGSCKIIPEDLHFVLRMRHTFESLGYQSGFYLSQLFSSNRTTSSSNTPLMASNHPL
LPTQTQPLQPTLPHYNWSGTSQRPMMPQTSLPTYQPHMTMPFPVMPHSNKEQDPDVKWPTGLSFFNALTNNVNAKLLFDS
EGLGDKTDHQNQSQEQSNSESQANPSEFLSLDSHHRNMSFLE*

DNA
ATGGTGGGCTCGGAACATCATCACCATCATCAACAACATCATCATCAAAACCATCAGCAGCAGCAACAAAGGAGCAAAGA
AGCTTTAGGGATGGTGGCTCTCCACGACGCCCTGAGAACTGTTTGTCTCAACACCGACTGGACTTACTCTGTCTTCTGGT
CCATCCGTCCCCGTCCGAGAGTTCGAGGCGGTGGCAACGGCTGCAAAGTTGGCGACGACAATGGAAGCTTGATGTTGATG
TGGGAAGATGGATACTGCAGAGGAAGAGGAGGAACAGAAGGTTGCTATGGAGACATGGAAGGAGAAGATCCTGTTCGTAA
ATCTTTCAGCAAGATGTCTATTCAGTTATATAATTATGGCGAAGGGTTAATGGGGAAGGTTGCTTCTGACAAATGCCATA
AATGGGTTTTCAAGGAACAAACTGAATCTGAATCTAATGCCTCTAGTTACTGGCAAAGCTCATTCGATGCTATTCCTTCA
GAGTGGAATGATCAGTTCGAATCTGGGATTCGGACCATAGCTGTTATTCAAGCCGGACATGGCCTTTTACAACTTGGTTC
TTGCAAGATTATACCTGAAGATCTGCACTTTGTTCTTCGGATGAGGCACACGTTTGAATCACTTGGCTACCAATCCGGAT
TTTACCTCTCTCAGCTCTTCTCCTCAAACCGAACCACTTCGTCTTCAAACACACCGCTCATGGCCTCGAACCACCCTCTA
CTACCTACACAGACTCAGCCATTGCAACCCACTCTTCCCCACTACAACTGGAGTGGTACGAGCCAACGACCAATGATGCC
TCAAACCTCTTTGCCTACCTACCAGCCTCACATGACTATGCCTTTCCCAGTAATGCCACACTCAAACAAAGAACAAGACC
CTGACGTGAAATGGCCCACGGGCCTATCTTTCTTCAATGCGTTGACTAACAATGTCAACGCTAAGCTTCTGTTTGATTCA
GAGGGGTTAGGTGACAAAACAGACCACCAGAACCAGAGCCAGGAACAGAGCAACTCTGAGAGTCAAGCGAATCCGAGCGA
GTTCTTGAGCCTTGATAGTCACCACCGAAACATGAGTTTCTTAGAGTGA